SYCE1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SYCE1 Antibody [NBP1-88971] - Staining in human testis and endometrium tissues using anti-SYCE1 antibody. Corresponding SYCE1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SYCE1 Antibody [NBP1-88971] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: SYCE1 Antibody [NBP1-88971] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SYCE1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SYCE1 Antibody - BSA Free (NBP1-88971) is a polyclonal antibody validated for use in IHC and WB. Anti-SYCE1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVASPKPLKGERPGAAHQAGPDVLIGQEDTLHPDLSPRGFQEIKEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYCE1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in (PMID: 25899990).
• Control Peptide:

  SYCE1 Protein (NBP1-88971PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SYCE1 Antibody - BSA Free

• synaptonemal complex central element protein 1

Background

Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologouschromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have arole in the synaptonemal complexe assembly, stabilization and recombination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SYCE1 Antibody (NBP1-88971)(1)

Publication using NBP1-88971

• Maor-Sagie E, Cinnamon Y, Yaacov B et al. Deleterious mutation in SYCE1 is associated with non-obstructive azoospermia J. Assist. Reprod. Genet. 2015-04-22 [PMID: 25899990] (WB, IHC-P, Human)

Bioinformatics

• Gene Symbol: SYCE1