SYCE1 Antibody

Images

 
Western Blot: SYCE1 Antibody [NBP1-88971] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: SYCE1 Antibody [NBP1-88971] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SYCE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QQQQQKRQRLKEELEKHGMQVPAQAQSTQEEEAGPGDVASPKPLKGERPGAAHQAGPDVLIGQEDTLHPDLSPRGFQEIKEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYCE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SYCE1 Protein (NBP1-88971PEP)
Publications
Read Publication using
NBP1-88971 in the following applications:

  • 1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SYCE1 Antibody

  • synaptonemal complex central element protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-90989
Species: Hu
Applications: WB, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-90637
Species: Hu
Applications: WB, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NBL1-16429
Species: Hu
H00079092-T01
Species: Hu
NBP2-19428
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-92431
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-93533
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-88971
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SYCE1 Antibody (NBP1-88971)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SYCE1 Antibody (NBP1-88971) (0)

There are no reviews for SYCE1 Antibody (NBP1-88971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SYCE1 Antibody (NBP1-88971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SYCE1 Products

SYCE1 NBP1-88971

Bioinformatics Tool for SYCE1 Antibody (NBP1-88971)

Discover related pathways, diseases and genes to SYCE1 Antibody (NBP1-88971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SYCE1 Antibody (NBP1-88971)

Discover more about diseases related to SYCE1 Antibody (NBP1-88971).
 

Pathways for SYCE1 Antibody (NBP1-88971)

View related products by pathway.

PTMs for SYCE1 Antibody (NBP1-88971)

Learn more about PTMs related to SYCE1 Antibody (NBP1-88971).

Blogs on SYCE1

There are no specific blogs for SYCE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SYCE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYCE1