![Western Blot: TEX101 Antibody [NBP2-94471] - Western blot analysis of extracts of A-549 cells, using TEX101 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/TEX101-Antibody-Western-Blot-NBP2-94471-img0001.jpg "Western Blot: TEX101 Antibody [NBP2-94471] - Western blot analysis of extracts of A-549 cells, using TEX101 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 44-150 of human TEX101 (NP_113639.4). LYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETTAS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TEX101 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TEX101 Antibody (NBP2-94471)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TEX101 |
![Immunohistochemistry-Paraffin: TEX101 Antibody [NBP2-94471] - Immunohistochemistry of paraffin-embedded Mouse testis using TEX101 Rabbit pAb (NBP2-94471) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/TEX101-Antibody-Immunohistochemistry-Paraffin-NBP2-94471-img0004.jpg "Immunohistochemistry-Paraffin: TEX101 Antibody [NBP2-94471] - Immunohistochemistry of paraffin-embedded Mouse testis using TEX101 Rabbit pAb (NBP2-94471) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: TEX101 Antibody [NBP2-94471] - Immunohistochemistry of paraffin-embedded Human colon using TEX101 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/TEX101-Antibody-Immunohistochemistry-Paraffin-NBP2-94471-img0002.jpg "Immunohistochemistry-Paraffin: TEX101 Antibody [NBP2-94471] - Immunohistochemistry of paraffin-embedded Human colon using TEX101 antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: TEX101 Antibody [NBP2-94471] - Immunohistochemistry of paraffin-embedded Rat testis using TEX101 Rabbit pAb (NBP2-94471) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/TEX101-Antibody-Immunohistochemistry-Paraffin-NBP2-94471-img0003.jpg "Immunohistochemistry-Paraffin: TEX101 Antibody [NBP2-94471] - Immunohistochemistry of paraffin-embedded Rat testis using TEX101 Rabbit pAb (NBP2-94471) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![N/A uPAR [HRP]](https://images.novusbio.com/images2/DATA_uPAR_DUP00_ELISA_866.jpg)
![N/A uPAR [HRP]](https://images.novusbio.com/images2/uPAR_DUP00_ELISA_203.jpg)
![Western Blot EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Western_Blot_16707.jpg)
![Immunohistochemistry EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Immunohistochemistry_17212.jpg)
![Knockout Validated EMMPRIN/CD147 Antibody [Unconjugated]](https://images.novusbio.com/images2/EMMPRIN_AF972_Knockout_Validated_22526.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")