![Western Blot: IZUMO1 Antibody [NBP1-83086] - Protein extracts from four different pig ejaculates and a human sample. Lanes F: fresh sperm. Lanes F-T: frozen-thawed sperm. Lanes H: human fresh sperm. Image from verified customer review.](http://images.novusbio.com/fullsize2/IZUMO1-Antibody-Western-Blot-NBP1-83086-img0017.jpg "Western Blot: IZUMO1 Antibody [NBP1-83086] - Protein extracts from four different pig ejaculates and a human sample. Lanes F: fresh sperm. Lanes F-T: frozen-thawed sperm. Lanes H: human fresh sperm. Image from verified customer review.")
| Reactivity | Hu, PoSpecies Glossary |
| Applications | WB, IHC, IHC-P, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQM |
| Specificity | Specificity of human IZUMO1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IZUMO1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry reported in scientific literature (PMID:31391940). |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83086 | Applications | Species |
|---|---|---|
| Llavanera M, Delgado-Bermúdez A, Fernandez-Fuertes B, et al. GSTM3, but not IZUMO1, is a cryotolerance marker of boar sperm. J Anim Sci Biotechnol. 2019 Aug 5 [PMID: 31391940] (WB, ICC, Human, Porcine) | WB, ICC | Human, Porcine |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Marc Llavanera |
WB | Pig and Human | 07/10/2019 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for IZUMO1 Antibody (NBP1-83086)Discover more about diseases related to IZUMO1 Antibody (NBP1-83086).
| Pathways for IZUMO1 Antibody (NBP1-83086)View related products by pathway.
|
PTMs for IZUMO1 Antibody (NBP1-83086)Learn more about PTMs related to IZUMO1 Antibody (NBP1-83086).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IZUMO1 |
![Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize2/IZUMO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83086-img0015.jpg "Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: IZUMO1 Antibody [NBP1-83086] - Analysis in control (vector only transfected HEK293T lysate) and IZUMO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/IZUMO1-Antibody-Western-Blot-NBP1-83086-img0011.jpg "Western Blot: IZUMO1 Antibody [NBP1-83086] - Analysis in control (vector only transfected HEK293T lysate) and IZUMO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Analysis in human testis and liver tissues. Corresponding IZUMO1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/IZUMO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83086-img0012.jpg "Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Analysis in human testis and liver tissues. Corresponding IZUMO1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize2/IZUMO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83086-img0013.jpg "Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human duodenum shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize2/IZUMO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83086-img0014.jpg "Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human duodenum shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human testis shows weak to moderate cytoplasmic positivity in spermatids.](http://images.novusbio.com/fullsize2/IZUMO1 Antibody-Immunohistochemistry-Paraffin-NBP1-83086-img0016.jpg "Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human testis shows weak to moderate cytoplasmic positivity in spermatids.")
![Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Staining of human peripheral blood with anti-CD9 (MEM-61) Alexa Fluor® 647.](http://images.novusbio.com/images2/CD9-Antibody-(MEM-61)-Flow-Cytometry-NB500-327-img0008.jpg)
![Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Surface staining of NALM-6 human pre-B cell leukemia cell line Total viable cells were used for analysis.](http://images.novusbio.com/images2/CD9-Antibody-(MEM-61)-Flow-Cytometry-NB500-327-img0001.jpg)
![Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Surface staining (mass cytometry) of PBMC after Ficoll-Paque separation with anti-human CD9 (MEM-61) Dy161.](http://images.novusbio.com/images2/CD9-Antibody-(MEM-61)-Flow-Cytometry-NB500-327-img0002.jpg)
![Western Blot: CLGN Antibody (1C8B6) [NBP2-37348] - Western blot analysis using CLGN mouse mAb against LNCAP cell lysate.](http://images.novusbio.com/images2/CLGN-Antibody-(1C8B6)-Western-Blot-NBP2-37348-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: CLGN Antibody (1C8B6) [NBP2-37348] - Immunofluorescence analysis of Hela cells using CLGN mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.](http://images.novusbio.com/images2/CLGN-Antibody-(1C8B6)-Immunocytochemistry-Immunofluorescence-NBP2-37348-img0005.jpg)
![Immunohistochemistry: CLGN Antibody (1C8B6) [NBP2-37348] - Immunohistochemical analysis of paraffin-embedded bladder cancer tissues using CLGN mouse mAb with DAB staining.](http://images.novusbio.com/images2/CLGN-Antibody-(1C8B6)-Immunohistochemistry-NBP2-37348-img0007.jpg)
![Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85416] - Staining in human testis and liver tissues using anti-ADAM2 antibody. Corresponding ADAM2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/ADAM2-Antibody-Immunohistochemistry-Paraffin-NBP1-85416-img0006.jpg)
![Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85416] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/images2/ADAM2-Antibody-Immunohistochemistry-Paraffin-NBP1-85416-img0003.jpg)
![Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85416] - Staining of human testis shows high expression.](http://images.novusbio.com/images2/ADAM2-Antibody-Immunohistochemistry-Paraffin-NBP1-85416-img0005.jpg)
![Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Western-Blot-NB100-524-img0018.jpg)
![Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Western-Blot-NB100-524-img0013.jpg)
![Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Immunohistochemistry-Frozen-NB100-524-img0016.jpg)
![Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).](http://images.novusbio.com/images2/HLA DQ Antibody (SPV-L3)-Flow Cytometry-NBP2-45041-img0001.jpg)
![Western Blot: TSSK6 Antibody (6F5) [H00083983-M02] - TSSK6 monoclonal antibody (M02), clone 6F5 Analysis of TSSK6 expression in Hela S3 NE.](http://images.novusbio.com/images2/TSSK6 Antibody (6F5)-Western Blot-H00083983-M02-img0002.jpg)
![Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. Western blot analysis for protein expressions of intrarenal RAS components in the two groups of mice. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Angiotensin-II-III-Antibody-(Ang-II-E7-(BGN-KA-4L))-Western-Blot-NB100-62346-img0002.jpg)
![Immunohistochemistry: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Protein expressions of intrarenal RAS components in two groups of mice. (A) Immunohistochemical analysis of intrarenal RAS expression position in the two groups of mice. AGT immunoreactivity in the proximal tubular cells, Ang II immunoreactivity in both glomerular and tubular cells, renin immunoreactivity in juxtaglomerular apparatus cells, ACE immunoreactivity in brush border membranes of proximal tubules as well as AT1 and AT2 immunoreactivity in the proximal tubules were increased in the HF group when compared to the control group. Image collected and cropped by CiteAb from the following publication (lipidworld.biomedcentral.com/articles/10.1186/1476-511X-12-49), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Angiotensin-II-III-Antibody-(Ang-II-E7-(BGN-KA-4L))-Immunohistochemistry-NB100-62346-img0003.jpg)
![Western Blot: Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) [NB100-62346] - Evaluation of angiotensis II expression in untreated UUO rat kidneys and UUO rat kidneys treated with Ang-(1-7).](http://images.novusbio.com/images2/Angiotensin-II-III-Antibody-(Ang-II-E7-(BGN-KA-4L))-Western-Blot-NB100-62346-img0001.jpg)
![Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.](http://images.novusbio.com/images2/Albumin-Antibody-Western-Blot-NB600-41532-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Albumin Antibody [NB600-41532] - NLRP12 downregulates multiple JNK activating pathways in hepatocytes. For checking the purity of primary hepatocytes, hepatocytes isolated from healthy WT and Nlrp12-/- mouse livers were immunostained with antibody for hepatocyte-specific marker Albumin and counterstained with DAPI. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40396), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Albumin-Antibody-Immunocytochemistry-Immunofluorescence-NB600-41532-img0003.jpg)
![Western Blot: SPAM1 Antibody [NBP1-81637] - Analysis in human testis tissue.](http://images.novusbio.com/images2/SPAM1-Antibody-Western-Blot-NBP1-81637-img0015.jpg)
![Immunohistochemistry-Paraffin: SPAM1 Antibody [NBP1-81637] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/images2/SPAM1-Antibody-Immunohistochemistry-Paraffin-NBP1-81637-img0013.jpg)
![Western Blot: SPAM1 Antibody [NBP1-81637] - Analysis in human testis tissue.](http://images.novusbio.com/images2/SPAM1-Antibody-Western-Blot-NBP1-81637-img0014.jpg)
![Western Blot: NKX2.5 Antibody [NBP1-31558] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Nkx2.5 antibody diluted at 1:1000.](http://images.novusbio.com/images2/NKX2.5-Antibody-Western-Blot-NBP1-31558-img0021.jpg)
![Immunocytochemistry/Immunofluorescence: NKX2.5 Antibody [NBP1-31558] - Paraformaldehyde-fixed mouse ESC D3, using antibody at 1:200 dilution.](http://images.novusbio.com/images2/NKX2.5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-31558-img0015.jpg)
![Immunohistochemistry-Paraffin: NKX2.5 Antibody [NBP1-31558] - Rat heart. Nkx2.5 stained by Nkx2.5 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.](http://images.novusbio.com/images2/NKX2.5-Antibody-Immunohistochemistry-Paraffin-NBP1-31558-img0022.jpg)
![Western Blot: HSD17B4 Antibody [NBP1-85296] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/images2/HSD17B4-Antibody-Western-Blot-NBP1-85296-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: HSD17B4 Antibody [NBP1-85296] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.](http://images.novusbio.com/images2/HSD17B4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85296-img0007.jpg)
![Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human lung.](http://images.novusbio.com/images2/HSD17B4-Antibody-Immunohistochemistry-Paraffin-NBP1-85296-img0012.jpg)
![Western Blot: alpha-Galactosidase A/GLA Antibody [NBP2-16576] - Whole cell extracts (30 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Galactosidase alpha antibody at a dilution of 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.](http://images.novusbio.com/images2/alpha-Galactosidase-A-GLA-Antibody-Western-Blot-NBP2-16576-img0008.jpg)
![Immunohistochemistry-Paraffin: alpha-Galactosidase A/GLA Antibody [NBP2-16576] - Analysis of paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.](http://images.novusbio.com/images2/alpha-Galactosidase-A-GLA-Antibody-Immunohistochemistry-Paraffin-NBP2-16576-img0009.jpg)
![Western Blot: alpha-Galactosidase A/GLA Antibody [NBP2-16576] - Sample (30 ug of whole cell lysate) A: Hela 10% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/images2/alpha-Galactosidase-A-GLA-Antibody-Western-Blot-NBP2-16576-img0010.jpg)
![Western Blot: D Box Binding Protein Antibody [NBP2-83996] - Host: Rabbit. Target Name: DBP. Sample Tissue: Human Fetal Liver. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/images2/D Box Binding Protein Antibody-Western Blot-NBP2-83996-img0003.jpg)
![Immunohistochemistry: D Box Binding Protein Antibody [NBP2-83996] - Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-DBP antibody](http://images.novusbio.com/images2/D-Box-Binding-Protein-Antibody-Immunohistochemistry-NBP2-83996-img0002.jpg)
![Immunohistochemistry: D Box Binding Protein Antibody [NBP2-83996] - Human Heart](http://images.novusbio.com/images2/D-Box-Binding-Protein-Antibody-Immunohistochemistry-NBP2-83996-img0001.jpg)
![Western Blot: TEX101 Antibody [NBP1-84357] - Analysis in human testis tissue.](http://images.novusbio.com/images2/TEX101-Antibody-Western-Blot-NBP1-84357-img0005.jpg)
![Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84357] - Staining of human testis using Anti-TEX101 antibody NBP1-84357.](http://images.novusbio.com/images2/TEX101-Antibody-Immunohistochemistry-Paraffin-NBP1-84357-img0014.jpg)
![Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84357] - Staining of human kidney shows low expression as expected.](http://images.novusbio.com/images2/TEX101-Antibody-Immunohistochemistry-Paraffin-NBP1-84357-img0006.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")