![Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Analysis in human testis and liver tissues. Corresponding IZUMO1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/IZUMO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83086-img0012.jpg "Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Analysis in human testis and liver tissues. Corresponding IZUMO1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, PoSpecies Glossary |
| Applications | WB, IHC, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit IZUMO1 Antibody - BSA Free (NBP1-83086) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-IZUMO1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IZUMO1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry reported in scientific literature (PMID:31391940). IZUMO1 antibody validated for WB from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP1-83086 | Applications | Species |
|---|---|---|
| Llavanera M, Delgado-Bermúdez A, Fernandez-Fuertes B, et al. GSTM3, but not IZUMO1, is a cryotolerance marker of boar sperm. J Anim Sci Biotechnol. 2019-08-05 [PMID: 31391940] (WB, ICC, Human, Porcine) | WB, ICC | Human, Porcine |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Marc Llavanera |
WB | Human and Pig | 07/10/2019 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IZUMO1 |
![Western Blot: IZUMO1 Antibody [NBP1-83086] - Protein extracts from four different pig ejaculates and a human sample. Lanes F: fresh sperm. Lanes F-T: frozen-thawed sperm. Lanes H: human fresh sperm. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize/IZUMO1-Antibody-Western-Blot-NBP1-83086-img0017.jpg "Western Blot: IZUMO1 Antibody [NBP1-83086] - Protein extracts from four different pig ejaculates and a human sample. Lanes F: fresh sperm. Lanes F-T: frozen-thawed sperm. Lanes H: human fresh sperm. Image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/IZUMO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83086-img0015.jpg "Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: IZUMO1 Antibody [NBP1-83086] - Analysis in control (vector only transfected HEK293T lysate) and IZUMO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/IZUMO1-Antibody-Western-Blot-NBP1-83086-img0011.jpg "Western Blot: IZUMO1 Antibody [NBP1-83086] - Analysis in control (vector only transfected HEK293T lysate) and IZUMO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/IZUMO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83086-img0013.jpg "Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human duodenum shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/IZUMO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83086-img0014.jpg "Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human duodenum shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human testis shows weak to moderate cytoplasmic positivity in spermatids.](http://images.novusbio.com/fullsize/IZUMO1-Antibody-Immunohistochemistry-Paraffin-NBP1-83086-img0016.jpg "Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human testis shows weak to moderate cytoplasmic positivity in spermatids.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-4120241239327.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412401270.jpg)
![Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]](https://images.novusbio.com/images/af2444_human-nkx2-5-affinity-purified-polyclonal-ab-41202412403531.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
