Home » IZUMO1 » IZUMO1 Antibodies » IZUMO1 Antibody

IZUMO1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: IZUMO1 Antibody [NBP1-83086] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: IZUMO1 Antibody [NBP1-83086] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining in human testis and colon tissues using anti-IZUMO1 antibody. Corresponding IZUMO1 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

IZUMO1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQM
Specificity
Specificity of human IZUMO1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IZUMO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IZUMO1 Recombinant Protein Antigen (NBP1-83086PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IZUMO1 Antibody

  • FLJ61440
  • izumo sperm-egg fusion 1
  • izumo sperm-egg fusion protein 1
  • IZUMO
  • IZUMO1
  • MGC34799
  • OBF
  • Oocyte binding/fusion factor
  • Sperm-specific protein izumo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD9 Antibody (5G6)
NBP2-22187
Western Blot: CD9 Antibody (5G6) [NBP2-22187] - Western blot analysis using CD9 mAb against HEK293 (1) and CD9(AA: 37-228)-hIgGFc transfected HEK293 (2) cell lysate.
Immunohistochemistry-Paraffin: CD9 Antibody (5G6) [NBP2-22187] - Immunohistochemical analysis of paraffin-embedded kidney cancer tissues using CD9 mouse mAb with DAB staining.
Flow Cytometry: CD9 Antibody (5G6) [NBP2-22187] - Flow cytometric analysis of Jurkat cells using CD9 mouse mAb (green) and negative control (red).
(1 Review)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
ACE/CD143 Antibody
[Unconjugated]
AF1513
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Review)
(3 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
CLGN Antibody
(1C8B6)
NBP2-37348
Western Blot: CLGN Antibody (1C8B6) [NBP2-37348] - Western blot analysis using CLGN mouse mAb against LNCAP cell lysate.
Immunocytochemistry/Immunofluorescence: CLGN Antibody (1C8B6) [NBP2-37348] - Immunofluorescence analysis of Hela cells using CLGN mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: CLGN Antibody (1C8B6) [NBP2-37348] - Immunohistochemical analysis of paraffin-embedded bladder cancer tissues using CLGN mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
ADAM2 Antibody
NBP1-85416
Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85416] - Staining in human testis and liver tissues using anti-ADAM2 antibody. Corresponding ADAM2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85416] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: ADAM2 Antibody [NBP1-85416] - Staining of human testis shows high expression.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
HLA DQA1 Antibody
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Species: Hu
Applications: WB, IHC, IHC-P
CTLA-4
7268-CT
CTLA-4
(2 Reviews)
(1 Publication)
Species: Hu
TSSK6 Antibody
(6F5)
H00083983-M02
Western Blot: TSSK6 Antibody (6F5) [H00083983-M02] - TSSK6 monoclonal antibody (M02), clone 6F5 Analysis of TSSK6 expression in Hela S3 NE.
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
Serpin
A8/Angiotensinogen An
NBP1-30027
Western Blot: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in human kidney lysate.
Immunocytochemistry/Immunofluorescence: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-Angiotensinogen at 10 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Serpin A8/Angiotensinogen Antibody [NBP1-30027] - Analysis of Angiotensinogen in mouse kidney using DAB with hematoxylin counterstain.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Albumin Antibody
NB600-41532
Western Blot: Albumin Antibody [NB600-41532] - Analysis using the HRP conjugate of NB600-41532. Detection of Albumin in whole mouse liver extracts. Image courtesy of anonymous customer product review.
(39 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
SPAM1 Antibody
NBP1-81637
Western Blot: SPAM1 Antibody [NBP1-81637] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SPAM1 Antibody [NBP1-81637] - Staining in human testis and endometrium tissues using anti-SPAM1 antibody. Corresponding SPAM1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SPAM1 Antibody [NBP1-81637] - Staining of human endometrium shows low expression as expected.
Species: Hu
Applications: WB, IHC, IHC-P
NKX2.5 Antibody
NBP1-31558
Western Blot: NKX2.5 Antibody [NBP1-31558] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with Nkx2.5 antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NKX2.5 Antibody [NBP1-31558] - Paraformaldehyde-fixed mouse ESC D3, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: NKX2.5 Antibody [NBP1-31558] - Paraffin-embedded rat heart. Nkx2.5 stained by Nkx2.5 antibody diluted at 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
HSD17B4 Antibody
(OTI4C4)
NBP2-46005
Western Blot: HSD17B4 Antibody (4C4) [NBP2-46005] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HSD17B4.
Immunohistochemistry: HSD17B4 Antibody (4C4) [NBP2-46005] - Analysis of Carcinoma of Human liver tissue.
Immunohistochemistry: HSD17B4 Antibody (4C4) [NBP2-46005] - Analysis of Human Ovary tissue.
(1 Review)
Species: Hu
Applications: WB, IHC, IF

alpha-Galactosidase A/
NBP1-89796
Immunohistochemistry-Paraffin: alpha-Galactosidase A/GLA Antibody [NBP1-89796] - Staining of human seminal vesicle shows high expression.
Immunohistochemistry-Paraffin: alpha-Galactosidase A/GLA Antibody [NBP1-89796] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: alpha-Galactosidase A/GLA Antibody [NBP1-89796] - Staining in human seminal vesicle and pancreas tissues using anti-GLA antibody. Corresponding GLA RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P
D Box Binding
Protein Knockout 293T ...
NBP2-65684
D Box Binding Protein Knockout 293T Cell Lysate
Species: Hu
TEX101 Antibody
NBP1-84357
Western Blot: TEX101 Antibody [NBP1-84357] - Analysis in human testis tissue.
Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84357] - Staining in human testis and kidney tissues using anti-TEX101 antibody. Corresponding TEX101 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84357] - Staining of human kidney shows low expression as expected.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IZUMO1 Antibody (NBP1-83086) (0)

There are no publications for IZUMO1 Antibody (NBP1-83086).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IZUMO1 Antibody (NBP1-83086) (0)

There are no reviews for IZUMO1 Antibody (NBP1-83086). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IZUMO1 Antibody (NBP1-83086) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for IZUMO1 Antibody (NBP1-83086)

Discover related pathways, diseases and genes to IZUMO1 Antibody (NBP1-83086). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IZUMO1 Antibody (NBP1-83086)

Discover more about diseases related to IZUMO1 Antibody (NBP1-83086).
 

Pathways for IZUMO1 Antibody (NBP1-83086)

View related products by pathway.

PTMs for IZUMO1 Antibody (NBP1-83086)

Learn more about PTMs related to IZUMO1 Antibody (NBP1-83086).

Blogs on IZUMO1

There are no specific blogs for IZUMO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IZUMO1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol IZUMO1
Entrez