IZUMO1 Antibody

Images

 
Western Blot: IZUMO1 Antibody [NBP1-83086] - Protein extracts from four different pig ejaculates and a human sample. Lanes F: fresh sperm. Lanes F-T: frozen-thawed sperm. Lanes H: human fresh sperm. Image from verified ...read more
Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human liver shows no positivity in hepatocytes as expected.
Western Blot: IZUMO1 Antibody [NBP1-83086] - Analysis in control (vector only transfected HEK293T lysate) and IZUMO1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Analysis in human testis and liver tissues. Corresponding IZUMO1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human duodenum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: IZUMO1 Antibody [NBP1-83086] - Staining of human testis shows weak to moderate cytoplasmic positivity in spermatids.

Product Details

Summary
Reactivity Hu, PoSpecies Glossary
Applications WB, IHC, IHC-P, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

IZUMO1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQM
Specificity
Specificity of human IZUMO1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IZUMO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Immunocytochemistry
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry reported in scientific literature (PMID:31391940).
Control Peptide
IZUMO1 Recombinant Protein Antigen (NBP1-83086PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-83086 in the following applications:

Publications
Read Publication using
NBP1-83086 in the following applications:

  • ICC
    1 publication
  • WB
    1 publication

Reactivity Notes

Porcine reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IZUMO1 Antibody

  • FLJ61440
  • izumo sperm-egg fusion 1
  • izumo sperm-egg fusion protein 1
  • IZUMO
  • IZUMO1
  • MGC34799
  • OBF
  • Oocyte binding/fusion factor
  • Sperm-specific protein izumo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-327
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, In vitro, CyTOF-ready
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-37348
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85416
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
H00083983-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85296
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16576
Species: Hu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-83996
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84357
Species: Hu
Applications: WB, IHC, IHC-P

Publications for IZUMO1 Antibody (NBP1-83086)(1)

We have publications tested in 2 confirmed species: Human, Porcine.

We have publications tested in 2 applications: ICC, WB.


Filter By Application
ICC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Porcine
(1)
All Species

Review for IZUMO1 Antibody (NBP1-83086) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Pig and Human.

Reviews using NBP1-83086:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Pig and Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot IZUMO1 NBP1-83086
Enlarge
5
reviewed by:
Marc Llavanera
WB Pig and Human 07/10/2019
View

Summary

ApplicationWestern Blot
Sample TestedSperm
SpeciesPig and Human
LotR34982

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IZUMO1 Antibody (NBP1-83086) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IZUMO1 Products

Bioinformatics Tool for IZUMO1 Antibody (NBP1-83086)

Discover related pathways, diseases and genes to IZUMO1 Antibody (NBP1-83086). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IZUMO1 Antibody (NBP1-83086)

Discover more about diseases related to IZUMO1 Antibody (NBP1-83086).
 

Pathways for IZUMO1 Antibody (NBP1-83086)

View related products by pathway.

PTMs for IZUMO1 Antibody (NBP1-83086)

Learn more about PTMs related to IZUMO1 Antibody (NBP1-83086).

Blogs on IZUMO1

There are no specific blogs for IZUMO1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Marc Llavanera
07/10/2019
Application: WB
Species: Pig and Human

Bioinformatics

Gene Symbol IZUMO1