ODF3 Antibody

Images

 
Western Blot: ODF3 Antibody [NBP2-32628] - Analysis in control (vector only transfected HEK293T lysate) and ODF3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, ...read more
Immunohistochemistry-Paraffin: ODF3 Antibody [NBP2-32628] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ODF3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EKSTKYVFDSAPSHSISARTKAFRVDSTPGPAAYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTPGPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ODF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ODF3 Protein (NBP2-32628PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ODF3 Antibody

  • CT135
  • hSHIPPO
  • outer dense fiber of sperm tails 3
  • outer dense fiber of sperm tails protein 3
  • outer dense fiber protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60018
Species: Hu
Applications: WB
NBP2-38050
Species: Hu
Applications: IHC, IHC-P
H00004957-M01
Species: Hu, Ce
Applications: WB, ELISA, ICC/IF, IHC
NBP2-31979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84357
Species: Hu
Applications: WB, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-84345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NBP2-31913
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-32628
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ODF3 Antibody (NBP2-32628) (0)

There are no publications for ODF3 Antibody (NBP2-32628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ODF3 Antibody (NBP2-32628) (0)

There are no reviews for ODF3 Antibody (NBP2-32628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ODF3 Antibody (NBP2-32628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ODF3 Products

Bioinformatics Tool for ODF3 Antibody (NBP2-32628)

Discover related pathways, diseases and genes to ODF3 Antibody (NBP2-32628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ODF3 Antibody (NBP2-32628)

Discover more about diseases related to ODF3 Antibody (NBP2-32628).
 

Pathways for ODF3 Antibody (NBP2-32628)

View related products by pathway.

Blogs on ODF3

There are no specific blogs for ODF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ODF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ODF3