TEX101 Antibody - BSA Free

Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84356] - Staining of human testis using Anti-TEX101 antibody NBP1-84356.

Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84356] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84356] - Staining in human testis and endometrium tissues using anti-TEX101 antibody. Corresponding TEX101 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84356] - Staining of human cerebral cortex, colon, testis and tonsil using Anti-TEX101 antibody NBP1-84356 (A) shows similar protein distribution across tissues to independent antibody NBP1-84357 (B).

Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84356] - Staining of human tonsil.

Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84356] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: TEX101 Antibody [NBP1-84356] - Staining of human colon.

Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TEX101 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TEX101 Antibody - BSA Free (NBP1-84356) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VTSYSNYCEDSFCNDKDSLSQFWEFSETTASTVSTTLHCPTCVALGTCFSAPSLPCPNGTTRCYQGKLEITG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TEX101
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TEX101 Protein (NBP1-84356PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TEX101 Antibody - BSA Free

• cancer/testis antigen 131
• Cell surface receptor NYD-SP8
• CT131
• MGC4766
• NYD-SP8
• PRO1884
• Scleroderma-associated autoantigen
• SGRGGTPR867
• Spermatogenesis-related gene protein
• TES101RP
• testis expressed 101
• testis expressed sequence 101
• testis-expressed protein 101
• testis-specific protein TES101RP

Background

ZNF45

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TEX101