Testican 1/SPOCK1 Antibody

Images

 
Immunohistochemistry-Paraffin: Testican 1/SPOCK1 Antibody [NBP1-87009] - Staining of human prostate shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Testican 1/SPOCK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FKDGKLSNNEWCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNELAGSRKQGAVSCEEEQETSGDFGSGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPOCK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Testican 1/SPOCK1 Protein (NBP1-87009PEP)
Publications
Read Publication using
NBP1-87009 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23998958).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Testican 1/SPOCK1 Antibody

  • FLJ37170
  • Protein SPOCK
  • sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1
  • SPOCK1
  • SPOCKcwcv and kazal-like domains proteoglycan (testican)
  • Testican 1
  • TIC1
  • TICN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF942
Species: Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF2328
Species: Hu, Mu, Rt
Applications: WB, IP
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2728
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
AF2346
Species: Mu
Applications: WB, IP
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
H00006941-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-90312
Species: Hu
Applications: IHC, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF1785
Species: Hu
Applications: WB, IHC, IP
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-80918
Species: Hu
Applications: IHC, IHC-P
NB100-93470
Species: Hu
Applications: WB, PEP-ELISA
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87009
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Testican 1/SPOCK1 Antibody (NBP1-87009)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Testican 1/SPOCK1 Antibody (NBP1-87009) (0)

There are no reviews for Testican 1/SPOCK1 Antibody (NBP1-87009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Testican 1/SPOCK1 Antibody (NBP1-87009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Testican 1/SPOCK1 Products

Bioinformatics Tool for Testican 1/SPOCK1 Antibody (NBP1-87009)

Discover related pathways, diseases and genes to Testican 1/SPOCK1 Antibody (NBP1-87009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Testican 1/SPOCK1 Antibody (NBP1-87009)

Discover more about diseases related to Testican 1/SPOCK1 Antibody (NBP1-87009).
 

Pathways for Testican 1/SPOCK1 Antibody (NBP1-87009)

View related products by pathway.

PTMs for Testican 1/SPOCK1 Antibody (NBP1-87009)

Learn more about PTMs related to Testican 1/SPOCK1 Antibody (NBP1-87009).

Blogs on Testican 1/SPOCK1

There are no specific blogs for Testican 1/SPOCK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Testican 1/SPOCK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPOCK1
Entrez