Secretogranin V Antibody - BSA Free

Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Analysis in human adrenal gland and skeletal muscle tissues using NBP1-90312 antibody. Corresponding Secretogranin V RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Secretogranin V Antibody [NBP1-90312] - Staining of human lymphoid tissues, pancreas, pituitary gland and skeletal muscle using Anti-Secretogranin V antibody NBP1-90312 (A) shows similar protein distribution across tissues to independent antibody NBP2-68983 (B).

Staining of human lymph node shows no positivity in germinal center cells and non-germinal center cells as expected.

Staining of human duodenum shows strong cytoplasmic positivity in enteroendocrine cells.

Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Staining of human adrenal gland shows strong cytoplasmic positivity in endocrine glandular cells.

Staining of human pituitary gland shows strong cytoplasmic positivity in endocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Secretogranin V Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Secretogranin V Antibody - BSA Free (NBP1-90312) is a polyclonal antibody validated for use in IHC. Anti-Secretogranin V Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSV
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCG5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Secretogranin V Protein (NBP1-90312PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Secretogranin V Antibody - BSA Free

• neuroendocrine protein 1 (7B2 protein)
• Pituitary polypeptide
• prohormone convertase chaperone
• secretogranin V (7B2 protein)
• Secretogranin V
• secretogranin-5
• Secretory granule endocrine protein I

Background

SGNE1 - secretory granule, neuroendocrine protein 1 (7B2 protein)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Secretogranin V Antibody (NBP1-90312)(1)

Publication using NBP1-90312

• Lindskog C, Korsgren O, Ponten F et al. Novel pancreatic beta cell-specific proteins: antibody-based proteomics for identification of new biomarker candidates. J Proteomics 2012-05-17 [PMID: 22465717]

Bioinformatics

• Gene Symbol: SCG5