TERF2IP Antibody - BSA Free

Western Blot: TERF2IP Antibody [NBP1-82433] - Analysis in control (vector only transfected HEK293T lysate) and TERF2IP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: TERF2IP Antibody [NBP1-82433] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies.

Immunohistochemistry-Paraffin: TERF2IP Antibody [NBP1-82433] - Immunohistochemical staining of human lymph node shows strong nuclear positivity in reaction center cells.

Western Blot: TERF2IP Antibody [NBP1-82433] - Analysis in human cell line SCLC-21H.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TERF2IP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: REFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEEEEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TERF2IP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TERF2IP Recombinant Protein Antigen (NBP1-82433PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TERF2IP Antibody - BSA Free

• dopamine receptor interacting protein 5
• Dopamine receptor-interacting protein 5
• DRIP5
• hRap1
• RAP1 homolog
• RAP1TERF2-interacting telomeric protein 1
• Repressor/activator protein 1 homolog
• telomeric repeat binding factor 2, interacting protein
• telomeric repeat-binding factor 2-interacting protein 1
• TRF2-interacting telomeric protein 1
• TRF2-interacting telomeric RAP1 protein

Background

Mammalian telomeric proteins, including TRF1, TRF2, tankyrase, and TIN2 have no recognized orthologs in budding yeast. However, human Rap1 (hRap1) is an ortholog of the yeast telomeric protein, scRap1p. hRap1 is a homodimer, has three conserved sequence motifs in common with scRap1, is located at telomeres, and plays a role in telomere length regulation. Although scRap1 binds telomeric DNA directly, hRap1 is recruited to telomeres by TRF2 and binds it with its C-terminus, rather than directly binding DNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TERF2IP Antibody (NBP1-82433)(1)

Publication using NBP1-82433

• Storchova R, Palek M, Palkova N et al. Phosphorylation of TRF2 promotes its interaction with TIN2 and regulates DNA damage response at telomeres Nucleic acids research 2023-01-18 [PMID: 36651296] (ICC/IF)

Bioinformatics

• Gene Symbol: TERF2IP