Tensin 1 Antibody

Immunocytochemistry/Immunofluorescence: Tensin 1 Antibody [NBP1-84129] - Adhesions are more mature and stable on PT compared to SLA. Co-localizations of tensin-1 and p-cortactin with vinculin were shown by immunocytochemical staining of HGFs cultured on PT and SLA surfaces at 24 hrs. Cells were labelled for integrin tensin-1 (red), vinculin (green), and nuclei (blue). Representative images of HGFs on PT and SLA observed under fluorescence microscopy. Grey scale images are shown for separate channels for tensin-1, and vinculin. Inserts show higher magnifications of focal contacts (white boxes). Image collected and cropped by CiteAb from the following publication (//doi.wiley.com/10.1111/jcmm.12451), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: Tensin 1 Antibody [NBP1-84129] - Staining of rat kidneys shows positivity in mesangial cells. Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: Tensin 1 Antibody [NBP1-84129] - Staining of human liver shows moderate membranous positivity in hepatocytes.

Immunohistochemistry-Paraffin: Tensin 1 Antibody [NBP1-84129] - Staining of human lung shows moderate positivity.

Immunohistochemistry-Paraffin: Tensin 1 Antibody [NBP1-84129] - Staining of human smooth muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: Tensin 1 Antibody [NBP1-84129] - Staining of human testis shows moderate membranous positivity.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Tensin 1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence -Reactivity reported in (PMID: 25766369).
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot -Reported in scientific literature (PMID: 30813060).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Tensin 1 Recombinant Protein Antigen (NBP1-84129PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33534863). Rat reactivity reported from a verified customer review (staining of rat kidneys shows positivity in mesangial cells).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Tensin 1 Antibody

• DKFZp586K0617
• matrix-remodelling associated 6
• Matrix-remodelling-associated protein 6
• MGC88584
• MST091
• MST122
• MST127
• MSTP127
• MXRA6
• tensin 1
• tensin
• tensin-1
• TNSMSTP122

Background

Tensin 1 (TNS1, human Tensin 1 theoretical molecular weight 186kDa) belongs to a family of focal adhesion proteins which in mammals includes three other members: Tensin 2, Tensin 3, and C-terminal tensin-like (Cten or Tensin 4) (1, 2). Tensins localize to focal adhesion sites, which are functional domains of the cellular membrane that mediate interactions between the actin cytoskeleton and the extracellular matrix (1). Transmembrane integrin receptors (alpha-beta heterodimer) predominate within focal adhesions and serve to bridge the interactions between extracellular components and the cytoskeleton (3). Tensin 1 interacts with both actin filaments and beta-integrin receptors within focal adhesion sites to mediate cellular responses to extracellular signals (1, 4). Several common functional domains are shared between some tensin family members including: 1) amino terminal PTEN-related tyrosine phosphatase (PTP) domain, 2) amino terminal actin-binding (ABD-1) domain, 3) amino terminal focal adhesion binding (FAB-N) domain, 4) carboxy terminal Src homology 2 (SH2) domain, 5) carboxy terminal phosphotyrosine binding (PTB) domain, and 6) carboxy terminal focal adhesion binding (FAB-C) domain (4). The PTB domain allows tensins to interact with beta-integrin cytoplasmic tails, while their SH2 domain supports interaction with tyrosine-phosphorylated signaling proteins (1). The interactions of tensins with focal adhesion kinases and phosphatases support diverse cellular processes such as attachment, migration, and polarization. Loss of function studies have revealed that tensin 1 plays a critical role for normal kidney function, skeletal muscle regeneration and angiogenesis (1).

References

1. Lo, S. H. (2017). Tensins. Current Biology. https://doi.org/10.1016/j.cub.2017.02.041

2. Lo, S. H. (2014). C-terminal tensin-like (CTEN): A promising biomarker and target for cancer. International Journal of Biochemistry and Cell Biology. https://doi.org/10.1016/j.biocel.2014.04.003

3. Armitage, S. K., & Plotnikov, S. V. (2016). Bridging the gap: A new study reveals that a protein called talin forms a vital link between microtubules and focal adhesions at the surface of cells. ELife. https://doi.org/10.7554/eLife.19733

4. Lo, S. H. (2006). Focal adhesions: What's new inside. Developmental Biology. https://doi.org/10.1016/j.ydbio.2006.03.029

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tensin 1 Antibody (NBP1-84129)(6)

Publications using NBP1-84129

• Brooks S, Mittler S, Hamilton DW Contact Guidance of Connective Tissue Fibroblasts on Submicrometer Anisotropic Topographical Cues Is Dependent on Tissue of Origin, ?1 Integrins, and Tensin-1 Recruitment ACS applied materials & interfaces 2023-04-26 [PMID: 37067372] (ICC/IF, Human)
• Benwell CJ, Taylor JAGE, Robinson SD Endothelial neuropilin-2 influences angiogenesis by regulating actin pattern development and alpha 5-integrin-p-FAK complex recruitment to assembling adhesion sites FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2021-08-01 [PMID: 34314542] (WB, ICC/IF)
• Jones CE, Sharick JT, Colbert SE et al. Pten regulates collagen fibrillogenesis by fibroblasts through SPARC PloS one 2021-02-03 [PMID: 33534863] (ICC/IF, Mouse)
• Hassanisaber H, Jafari L, Campeau M et al. The effect of substrate bulk stiffness on focal and fibrillar adhesion formation in human abdominal aortic endothelial cells. Materials Science and Engineering: C 1905-07-11 [PMID: 30813060] (WB, Human)
• Goreczny GJ, Forsythe IJ, Turner CE. Hic-5 regulates fibrillar adhesion formation to control tumor extracellular matrix remodeling through interaction with tensin1 Oncogene 2018-01-19 [PMID: 29348458] (Human)
• Kim SS, Wen W, Prowse P, Hamilton DW. Regulation of matrix remodelling phenotype in gingival fibroblasts by substratum topography. J. Cell. Mol. Med. 2015-03-12 [PMID: 25766369] (ICC/IF, Human)

Review for Tensin 1 Antibody (NBP1-84129) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Rat.

reviewed by: Verified Customer IHC-P Rat 05/29/2013

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Mesangial cells in rat kidneys
• Species: Rat

Bioinformatics

• Gene Symbol: TNS1