Tensin 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Tensin 1 Antibody [NBP1-84129] - Adhesions are more mature and stable on PT compared to SLA. Co-localizations of tensin-1 and p-cortactin with vinculin were shown by ...read more
Immunohistochemistry-Paraffin: Tensin 1 Antibody [NBP1-84129] - Staining of rat kidneys shows positivity in mesangial cells. Image provided via product review by verified customer.
Immunohistochemistry-Paraffin: Tensin 1 Antibody [NBP1-84129] - Staining of human liver shows moderate membranous positivity in hepatocytes.
Immunohistochemistry-Paraffin: Tensin 1 Antibody [NBP1-84129] - Staining of human lung shows moderate positivity.
Immunohistochemistry-Paraffin: Tensin 1 Antibody [NBP1-84129] - Staining of human smooth muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Tensin 1 Antibody [NBP1-84129] - Staining of human testis shows moderate membranous positivity.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tensin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYK
Specificity
Specificity of human Tensin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reactivity reported in (PMID: 25766369). Tensin 1 antibody validated for IHC-P from a verified customer review. Use in WB reported in scientific literature (PMID: 30813060).
Control Peptide
Tensin 1 Recombinant Protein Antigen (NBP1-84129PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-84129 in the following applications:

Publications
Read Publications using
NBP1-84129 in the following applications:

Reactivity Notes

Rat reactivity reported from a verified customer review (staining of rat kidneys shows positivity in mesangial cells).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tensin 1 Antibody

  • DKFZp586K0617
  • matrix-remodelling associated 6
  • Matrix-remodelling-associated protein 6
  • MGC88584
  • MST091
  • MST122
  • MST127
  • MSTP127
  • MXRA6
  • tensin 1
  • tensin
  • tensin-1
  • TNSMSTP122

Background

Tensin 1 (TNS1, human Tensin 1 theoretical molecular weight 186kDa) belongs to a family of focal adhesion proteins which in mammals includes three other members: Tensin 2, Tensin 3, and C-terminal tensin-like (Cten or Tensin 4) (1, 2). Tensins localize to focal adhesion sites, which are functional domains of the cellular membrane that mediate interactions between the actin cytoskeleton and the extracellular matrix (1). Transmembrane integrin receptors (alpha-beta heterodimer) predominate within focal adhesions and serve to bridge the interactions between extracellular components and the cytoskeleton (3). Tensin 1 interacts with both actin filaments and beta-integrin receptors within focal adhesion sites to mediate cellular responses to extracellular signals (1, 4). Several common functional domains are shared between some tensin family members including: 1) amino terminal PTEN-related tyrosine phosphatase (PTP) domain, 2) amino terminal actin-binding (ABD-1) domain, 3) amino terminal focal adhesion binding (FAB-N) domain, 4) carboxy terminal Src homology 2 (SH2) domain, 5) carboxy terminal phosphotyrosine binding (PTB) domain, and 6) carboxy terminal focal adhesion binding (FAB-C) domain (4). The PTB domain allows tensins to interact with beta-integrin cytoplasmic tails, while their SH2 domain supports interaction with tyrosine-phosphorylated signaling proteins (1). The interactions of tensins with focal adhesion kinases and phosphatases support diverse cellular processes such as attachment, migration, and polarization. Loss of function studies have revealed that tensin 1 plays a critical role for normal kidney function, skeletal muscle regeneration and angiogenesis (1).

References

1. Lo, S. H. (2017). Tensins. Current Biology. https://doi.org/10.1016/j.cub.2017.02.041

2. Lo, S. H. (2014). C-terminal tensin-like (CTEN): A promising biomarker and target for cancer. International Journal of Biochemistry and Cell Biology. https://doi.org/10.1016/j.biocel.2014.04.003

3. Armitage, S. K., & Plotnikov, S. V. (2016). Bridging the gap: A new study reveals that a protein called talin forms a vital link between microtubules and focal adhesions at the surface of cells. ELife. https://doi.org/10.7554/eLife.19733

4. Lo, S. H. (2006). Focal adhesions: What's new inside. Developmental Biology. https://doi.org/10.1016/j.ydbio.2006.03.029

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP2-93729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-84129
Species: Hu, Rt, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Tensin 1 Antibody (NBP1-84129)(3)

Review for Tensin 1 Antibody (NBP1-84129) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-84129:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Tensin 1 NBP1-84129
Enlarge
4
reviewed by:
Corey.
IHC-P Rat 05/29/2013
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedMesangial cells in rat kidneys
SpeciesRat
CommentsThis antibody shows strong binding to mesangial cells in rat kidneys.

Primary Anitbody

Dilution Ratio1:20 dilution overnight at 4C

Secondary Antibody

Secondary DescriptionCy3 tagged secondary

Details

Detection NotesDAPI counterstain, 600x magnification with a trichrome filter
Fixation DetailsFormalin fixed pretreated at 95C in pH 8.5 for 36min

Comments

CommentsThis antibody shows strong binding to mesangial cells in rat kidneys.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Tensin 1 Antibody (NBP1-84129) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Tensin 1 Products

Bioinformatics Tool for Tensin 1 Antibody (NBP1-84129)

Discover related pathways, diseases and genes to Tensin 1 Antibody (NBP1-84129). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tensin 1 Antibody (NBP1-84129)

Discover more about diseases related to Tensin 1 Antibody (NBP1-84129).
 

Pathways for Tensin 1 Antibody (NBP1-84129)

View related products by pathway.

Research Areas for Tensin 1 Antibody (NBP1-84129)

Find related products by research area.

Blogs on Tensin 1

There are no specific blogs for Tensin 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Corey.
05/29/2013
Application: IHC-P
Species: Rat

Bioinformatics

Gene Symbol TNS1