TENC1 Antibody

Images

 
Immunohistochemistry-Paraffin: TENC1 Antibody [NBP1-90698] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry: TENC1 Antibody [NBP1-90698] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: TENC1 Antibody [NBP1-90698] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TENC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQQPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TENC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TENC1 Protein (NBP1-90698PEP)
Publications
Read Publication using
NBP1-90698 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 22786655).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TENC1 Antibody

  • FLJ16320
  • tensin like C1 domain containing phosphatase (tensin 2)
  • tensin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-917
Species: Hu, Mu
Applications: IHC, IHC-P, IF
NBP2-67796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF2228
Species: Hu
Applications: WB, IHC, ICC
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-93935
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF2396
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84129
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90698
Species: Hu
Applications: IHC, IHC-P

Publications for TENC1 Antibody (NBP1-90698)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TENC1 Antibody (NBP1-90698) (0)

There are no reviews for TENC1 Antibody (NBP1-90698). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TENC1 Antibody (NBP1-90698) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TENC1 Products

Array NBP1-90698

Bioinformatics Tool for TENC1 Antibody (NBP1-90698)

Discover related pathways, diseases and genes to TENC1 Antibody (NBP1-90698). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TENC1 Antibody (NBP1-90698)

Discover more about diseases related to TENC1 Antibody (NBP1-90698).
 

Pathways for TENC1 Antibody (NBP1-90698)

View related products by pathway.

PTMs for TENC1 Antibody (NBP1-90698)

Learn more about PTMs related to TENC1 Antibody (NBP1-90698).

Blogs on TENC1

There are no specific blogs for TENC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TENC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TENC1