Tenascin X Antibody - BSA Free

Staining of human cell line U2OS shows localization to vesicles.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tenascin X Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tenascin X Antibody - BSA Free (NBP3-25332) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Tenascin X using the following amino acid sequence: PSSQLYEHTVEGGEKQVVFTHRINLPPSTGCGCPPGTEPPVLASEVQALRVRLEILEELVKGLKEQCTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDA
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNXB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Tenascin X Antibody - BSA Free

• Hexabrachion-like protein
• HXBL
• Tenascin X
• tenascin XB
• tenascin XB2
• tenascin-X
• TNX
• TNXB
• TNXB1growth-inhibiting protein 45
• TNXB2tenascin XB1
• TNXBS
• TNXBSTNXTENX
• XB
• XBS
• XB-S
• XBTN-X

Background

Tenascin is a high molecular weight, multifunctional, extracellular matrix glycoprotein expressed in association with mesenchymal-epithelial interactions during development and in the neovasculature and stroma of undifferentiated tumors (Erickson and Bourdon 1989).It has been described under a variety of names: cytotactin, hexabrachion protein, J1, myotendinous antigen (MI) and glioma mesenchymal extracellular matrix (GMEM).The tenascin molecule is a disulfide-linked hexamer.The expression of tenascin is associated with development and growth, both normal and pathological, whereas the distribution in normal adult tissue is restricted.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNXB