Tenascin R Antibody - BSA Free

Analysis in human cerebral cortex and skeletal muscle tissues Corresponding TNR RNA-seq data are presented for the same tissues.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human cervix, uterine shows no positivity in squamous epithelial cells as expected.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neuropil.

Staining of human cerebellum shows strong cytoplasmic positivity in neuropil.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tenascin R Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tenascin R Antibody - BSA Free (NBP1-86399) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QGLQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEYIVNVVALK
• Predicted Species: Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Tenascin R Protein (NBP1-86399PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Tenascin R Antibody - BSA Free

• Janusin
• MGC149328
• Restrictin
• tenascin R (restrictin, janusin)
• Tenascin R
• tenascin-R
• TNR
• TN-R

Background

TNR - tenascin R (restrictin, janusin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNR