Tenascin C Antibody

Images

 
Immunohistochemistry-Paraffin: Tenascin C Antibody [NBP1-89639] - Staining of human hippocampus shows distinct positivity in neuropil.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tenascin C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
Tenascin C Protein (NBP1-89639PEP)
Publications
Read Publications using
NBP1-89639 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%). Reactivity reported in scientific literature (PMID: 19561339)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tenascin C Antibody

  • 150-225
  • Cytotactin
  • Glioma-associated-extracellular matrix antigen
  • GMEM
  • GP 150-225
  • hexabrachion (tenascin C, cytotactin)
  • hexabrachion (tenascin)
  • Hexabrachion
  • HXB
  • HXBcytotactin
  • JI
  • MGC167029
  • Myotendinous antigen
  • neuronectin
  • Tenascin C
  • Tenascin J1
  • tenascin
  • tenascin-C isoform 14/AD1/16
  • Tenascin-C
  • TNC
  • TN-C
  • TNGP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
AF3865
Species: Hu
Applications: WB, IHC
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28872
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
AF6999
Species: Hu
Applications: WB, Simple Western, IHC
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-76941
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF1095
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NBP1-89639
Species: Hu
Applications: IHC, IHC-P

Publications for Tenascin C Antibody (NBP1-89639)(5)

Reviews for Tenascin C Antibody (NBP1-89639) (0)

There are no reviews for Tenascin C Antibody (NBP1-89639). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tenascin C Antibody (NBP1-89639). (Showing 1 - 1 of 1 FAQs).

  1. One of our clients is looking for antibodies against tenascin C and fibronectin that could be used for FFPE rat tissues. These antibodies should exclusively recognize tenascin C and fibronectin and do not cross react with each other. Can you inform me if you have these antibodies?
    • Here is a link to Tenascin C antibodies we have validated in rat tissues for IHC-P Here are antibodies we have validated in fibronectin in rat tissues for IHC-P

Secondary Antibodies

 

Isotype Controls

Additional Tenascin C Antibody Products

Related Products by Gene

Bioinformatics Tool for Tenascin C Antibody (NBP1-89639)

Discover related pathways, diseases and genes to Tenascin C Antibody (NBP1-89639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tenascin C Antibody (NBP1-89639)

Discover more about diseases related to Tenascin C Antibody (NBP1-89639).
 

Pathways for Tenascin C Antibody (NBP1-89639)

View related products by pathway.

PTMs for Tenascin C Antibody (NBP1-89639)

Learn more about PTMs related to Tenascin C Antibody (NBP1-89639).
 

Research Areas for Tenascin C Antibody (NBP1-89639)

Find related products by research area.

Blogs on Tenascin C

There are no specific blogs for Tenascin C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tenascin C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNC
Entrez
Uniprot

Customers Who Bought This Also Bought