Tenascin C Antibody

Images

 
Western Blot: Tenascin C Antibody [NBP1-89639] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver ...read more
Immunohistochemistry-Paraffin: Tenascin C Antibody [NBP1-89639] - Staining of human hippocampus shows distinct positivity in neuropil.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

Tenascin C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
Tenascin C Protein (NBP1-89639PEP)
Publications
Read Publications using
NBP1-89639 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%). Reactivity reported in scientific literature (PMID: 19561339)

Alternate Names for Tenascin C Antibody

  • 150-225
  • Cytotactin
  • Glioma-associated-extracellular matrix antigen
  • GMEM
  • GP 150-225
  • hexabrachion (tenascin C, cytotactin)
  • hexabrachion (tenascin)
  • Hexabrachion
  • HXB
  • HXBcytotactin
  • JI
  • MGC167029
  • Myotendinous antigen
  • neuronectin
  • Tenascin C
  • Tenascin J1
  • tenascin
  • tenascin-C isoform 14/AD1/16
  • Tenascin-C
  • TNC
  • TN-C
  • TNGP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3865
Species: Hu
Applications: WB, IHC
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28872
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88899
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6999
Species: Hu
Applications: WB, Simple Western, IHC
NB600-1342
Species: Hu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-76941
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB8967
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-89639
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Tenascin C Antibody (NBP1-89639)(5)

Reviews for Tenascin C Antibody (NBP1-89639) (0)

There are no reviews for Tenascin C Antibody (NBP1-89639). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tenascin C Antibody (NBP1-89639). (Showing 1 - 1 of 1 FAQs).

  1. One of our clients is looking for antibodies against tenascin C and fibronectin that could be used for FFPE rat tissues. These antibodies should exclusively recognize tenascin C and fibronectin and do not cross react with each other. Can you inform me if you have these antibodies?
    • Here is a link to Tenascin C antibodies we have validated in rat tissues for IHC-P Here are antibodies we have validated in fibronectin in rat tissues for IHC-P

Secondary Antibodies

 

Isotype Controls

Additional Tenascin C Antibody Products

Related Products by Gene

Bioinformatics Tool for Tenascin C Antibody (NBP1-89639)

Discover related pathways, diseases and genes to Tenascin C Antibody (NBP1-89639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tenascin C Antibody (NBP1-89639)

Discover more about diseases related to Tenascin C Antibody (NBP1-89639).
 

Pathways for Tenascin C Antibody (NBP1-89639)

View related products by pathway.

PTMs for Tenascin C Antibody (NBP1-89639)

Learn more about PTMs related to Tenascin C Antibody (NBP1-89639).
 

Research Areas for Tenascin C Antibody (NBP1-89639)

Find related products by research area.

Blogs on Tenascin C

There are no specific blogs for Tenascin C, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol TNC
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-89639 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought