Tenascin C Antibody - BSA Free

Immunohistochemistry-Paraffin: Tenascin C Antibody [NBP1-89639] - Staining of human hippocampus shows distinct positivity in neuropil.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Tenascin C Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Tenascin C Antibody - BSA Free (NBP1-89639) is a polyclonal antibody validated for use in IHC and WB. Anti-Tenascin C Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNC
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Reactivity reported in (PMID: 24338924)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Tenascin C Protein (NBP1-89639PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Tenascin C Antibody - BSA Free

• 150-225
• Cytotactin
• Glioma-associated-extracellular matrix antigen
• GMEM
• GP 150-225
• hexabrachion (tenascin C, cytotactin)
• hexabrachion (tenascin)
• Hexabrachion
• HXB
• HXBcytotactin
• JI
• MGC167029
• Myotendinous antigen
• neuronectin
• Tenascin C
• Tenascin J1
• tenascin
• tenascin-C isoform 14/AD1/16
• Tenascin-C
• TNC
• TN-C
• TNGP

Background

Tenascin, also known as hexabrachion and cytotactin, is an extracellular matrix protein with a spatially and temporally restricted tissue distribution. It is a hexameric, multidomain protein with disulfide linked subunits of 190 to 240 kD, originally characterized as 'myotendinous antigen.' In the embryo it is present in dense mesenchyme surrounding developing epithelia and in developing cartilage and bone. In the adult, tenascin remains present in tendons and myotendinous junctions in the perichondrium and periosteum, as well as in smooth muscle. Tenascin (TN)(Erickson and Bourdon 1989, Erickson 1993) is a high molecular weight, multifunctional, extracellular matrix glycoprotein, expressed in association with mesenchymal-epithelial interactions during development and in the neovasculature and stroma of undifferentiated tumors. It has been described under a variety of names: cytotactin, hexabrachion protein, J1-200/220, myotendinous antigen (MI), neuronectin (NEC1) and glioma mesenchymal extracellular matrix (GMEM). The TN molecule is a disulfide-linked hexamer. Human TN has 3 subunits of 190, 200 and 220 kDa. It is primarily made up of 14.5 epidermal growth-factor-like repeats, 15 units similar to the fibronectin type-III-homology repeat and, at the C-terminus, has a sequence with homology to the globular domain of the beta and gamma chain of fibrinogen. Monoclonal antibody reacting specifically with tenascin is an essential tool for the localization, identification and studies on the role of the molecule in epithelial-mesenchymal and neuronal-glial interactions (Castellucci et al. 1991, Balza et al. 1993).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Tenascin C Antibody (NBP1-89639)(5)

Publications using NBP1-89639

• Xu Y, Li Z, Jiang P et al. The co-expression of MMP-9 and Tenascin-C is significantly associated with the progression and prognosis of pancreatic cancer. Diagn Pathol 2015-12-10 [PMID: 26652622] (IF/IHC, Human)
• Bohonowych J, Hance M, Nolan K et al. Extracellular Hsp90 mediates an NF-kappa dependent inflammatory stromal program: Implications for the prostate tumor microenvironment. Prostate 2014-04-01 [PMID: 24338924] (WB)
• Edlund K, Lindskog C, Saito A et al. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. Int J Cancer 2012-11-15 [PMID: 22392539]
• Ghosh Z, Huang M, Hu S et al. Dissecting the oncogenic and tumorigenic potential of differentiated human induced pluripotent stem cells and human embryonic stem cells. Cancer Res 2011-07-15 [PMID: 21646469]
• Schenke-Layland K, Stock UA, Nsair A et al. Cardiomyopathy is associated with structural remodelling of heart valve extracellular matrix. Eur Heart J 2009-09-01 [PMID: 19561339]

FAQs for Tenascin C Antibody (NBP1-89639). (Showing 1 - 1 of 1 FAQs).

1. One of our clients is looking for antibodies against tenascin C and fibronectin that could be used for FFPE rat tissues. These antibodies should exclusively recognize tenascin C and fibronectin and do not cross react with each other. Can you inform me if you have these antibodies?
   • Here is a link to Tenascin C antibodies we have validated in rat tissues for IHC-P Here are antibodies we have validated in fibronectin in rat tissues for IHC-P

Bioinformatics

• Gene Symbol: TNC