TEKT1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse TEKT1 (NP_035699). Peptide sequence EEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKL |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TEKT1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
49 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for TEKT1 Antibody - BSA Free
Background
anti-DKFZp586B1122 antibody, anti-FLJ12895 antibody, anti-FLJ44152 antibody, anti-MGC2427 antibody, anti-MGC4074 antibody, anti-MGC8682 antibody, anti-ZNF447 antibody, DKFZp586B1122, FLJ12895, FLJ44152, MGC2427, MGC4074, MGC8682, ZNF447
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PCR, PEP-ELISA, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Mu
Applications: WB
Publications for TEKT1 Antibody (NBP3-09258) (0)
There are no publications for TEKT1 Antibody (NBP3-09258).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TEKT1 Antibody (NBP3-09258) (0)
There are no reviews for TEKT1 Antibody (NBP3-09258).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TEKT1 Antibody (NBP3-09258) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TEKT1 Products
Blogs on TEKT1