Dynein heavy chain Antibody - BSA Free

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671] - Staining of human bronchus shows strong positivity in respiratory epithelial cells.

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671] - Staining of human fallopian tube shows high expression.

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671] - Staining in human fallopian tube and prostate tissues using anti-DNAH9 antibody. Corresponding DNAH9 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Dynein heavy chain Antibody [NBP2-38671] - Staining of human prostate shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dynein heavy chain Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Dynein heavy chain Antibody - BSA Free (NBP2-38671) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAH9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Dynein heavy chain Protein (NBP2-38671PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Dynein heavy chain Antibody - BSA Free

• axonemal, heavy polypeptide 9
• ciliary dynein heavy chain 9
• DNAH9 variant protein
• DYH9
• dynein heavy chain 9, axonemal
• dynein, axonemal, heavy chain 9
• HL20

Background

Dynein heavy chain 9, axonemal is a protein that has three isoforms, with lengths of 4486, 4410, and 798 amino acids and weights of approximately 512, 503, and 798 kDa respectively. Dynein heavy chain generates force at the minus end of the microtubules that make up cilia which occurs due to the use of ADP that dynein obtains through ATPase activity. Current research is being done on diseases and disorders linked to this protein including ciliary dyskinesia, Kartagener syndrome, bronchiectasis, and malaria. Dynein heavy chain has also been shown to have interactions with BCL6, DNAH1, DNAH17, DNAH2, and DNAH3 in pathways such as the cytoplasmic microtubules pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAH9
• Uniprot:
  • Q9NYC9(Human)