TEKT1 Antibody - BSA Free

Immunohistochemistry: TEKT1 Antibody [NBP2-49363] - Staining of human bronchus shows cilia positivity in respiratory epithelial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TEKT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TEKT1 Antibody - BSA Free (NBP2-49363) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSLEDWLDFSSTNV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TEKT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TEKT1 Recombinant Protein Antigen (NBP2-49363PEP)

Reactivity Notes

Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TEKT1 Antibody - BSA Free

• tektin 1
• tektin-1

Background

anti-DKFZp586B1122 antibody, anti-FLJ12895 antibody, anti-FLJ44152 antibody, anti-MGC2427 antibody, anti-MGC4074 antibody, anti-MGC8682 antibody, anti-ZNF447 antibody, DKFZp586B1122, FLJ12895, FLJ44152, MGC2427, MGC4074, MGC8682, ZNF447

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TEKT1