FoxJ1/HFH4 Antibody

Images

 
Immunohistochemistry-Frozen: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of FoxJ1 in airway epithelium of mouse. Image from verified customer review.
Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human endometrium shows strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human fallopian tube shows strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human liver shows no positivity as expected.
Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Staining in human fallopian tube and liver tissues. Corresponding FOXJ1 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FoxJ1/HFH4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Specificity
Specificity of human FoxJ1/HFH4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXJ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. FoxJ1/HFH4 antibody validated for IHC-Frozen from a verified customer review.
Control Peptide
FoxJ1/HFH4 Protein (NBP1-87928PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-87928 in the following applications:

Publications
Read Publications using
NBP1-87928 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24899310)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxJ1/HFH4 Antibody

  • FKHL13
  • FKHL13forkhead transcription factor HFH-4
  • forkhead box J1
  • forkhead-like 13
  • Forkhead-related protein FKHL13
  • FoxJ1
  • Hepatocyte nuclear factor 3 forkhead homolog 4
  • HFH-4
  • HFH4fork head homologue 4
  • HFH-4forkhead box protein J1
  • MGC35202

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4218
Species: Hu
Applications: WB, IHC
NBP2-16518
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2400
Species: Hu
Applications: WB, IHC, ChIP, ICC
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45354
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
AF4186
Species: Hu
Applications: WB, ICC
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-45736
Species: Hu
Applications: WB, IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-77431
Species: Hu
Applications: WB, IHC
NBP2-87461
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87928
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P

Publications for FoxJ1/HFH4 Antibody (NBP1-87928)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for FoxJ1/HFH4 Antibody (NBP1-87928) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-87928:
Filter by Applications
IHC-Fr
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Frozen FoxJ1/HFH4 NBP1-87928
Enlarge
3
reviewed by:
Anonymous
IHC-Fr Mouse 04/18/2019
View

Summary

ApplicationImmunohistochemistry-Frozen
Sample TestedAirway epithelium
SpeciesMouse
Lotg1144396

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FoxJ1/HFH4 Antibody (NBP1-87928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FoxJ1/HFH4 Products

Bioinformatics Tool for FoxJ1/HFH4 Antibody (NBP1-87928)

Discover related pathways, diseases and genes to FoxJ1/HFH4 Antibody (NBP1-87928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxJ1/HFH4 Antibody (NBP1-87928)

Discover more about diseases related to FoxJ1/HFH4 Antibody (NBP1-87928).
 

Pathways for FoxJ1/HFH4 Antibody (NBP1-87928)

View related products by pathway.

PTMs for FoxJ1/HFH4 Antibody (NBP1-87928)

Learn more about PTMs related to FoxJ1/HFH4 Antibody (NBP1-87928).
 

Research Areas for FoxJ1/HFH4 Antibody (NBP1-87928)

Find related products by research area.

Blogs on FoxJ1/HFH4

There are no specific blogs for FoxJ1/HFH4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Anonymous
04/18/2019
Application: IHC-Fr
Species: Mouse

Bioinformatics

Gene Symbol FOXJ1