FoxJ1/HFH4 Antibody

Images

 
Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Immunohistochemical staining of human fallopian tube shows strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Immunohistochemical staining of human endometrium shows strong nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: FoxJ1/HFH4 Antibody [NBP1-87928] - Immunohistochemical staining of human liver shows no positivity as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FoxJ1/HFH4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXJ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FoxJ1/HFH4 Protein (NBP1-87928PEP)
Publications
Read Publication using NBP1-87928.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24899310)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxJ1/HFH4 Antibody

  • FKHL13
  • FKHL13forkhead transcription factor HFH-4
  • forkhead box J1
  • forkhead-like 13
  • Forkhead-related protein FKHL13
  • FoxJ1
  • Hepatocyte nuclear factor 3 forkhead homolog 4
  • HFH-4
  • HFH4fork head homologue 4
  • HFH-4forkhead box protein J1
  • MGC35202

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4218
Species: Hu
Applications: WB, IHC
NBP2-03868
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
AF4186
Species: Hu
Applications: WB, ICC
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00094234-M07
Species: Hu
Applications: ELISA, ICC/IF
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57977
Species: Hu
Applications: WB, IHC
NBP2-55686
Species: Hu
Applications: ICC/IF
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FoxJ1/HFH4 Antibody (NBP1-87928)(1)


Reviews for FoxJ1/HFH4 Antibody (NBP1-87928) (0)

There are no reviews for FoxJ1/HFH4 Antibody (NBP1-87928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FoxJ1/HFH4 Antibody (NBP1-87928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxJ1/HFH4 Products

Bioinformatics Tool for FoxJ1/HFH4 Antibody (NBP1-87928)

Discover related pathways, diseases and genes to FoxJ1/HFH4 Antibody (NBP1-87928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxJ1/HFH4 Antibody (NBP1-87928)

Discover more about diseases related to FoxJ1/HFH4 Antibody (NBP1-87928).
 

Pathways for FoxJ1/HFH4 Antibody (NBP1-87928)

View related products by pathway.

PTMs for FoxJ1/HFH4 Antibody (NBP1-87928)

Learn more about PTMs related to FoxJ1/HFH4 Antibody (NBP1-87928).
 

Research Areas for FoxJ1/HFH4 Antibody (NBP1-87928)

Find related products by research area.

Blogs on FoxJ1/HFH4

There are no specific blogs for FoxJ1/HFH4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxJ1/HFH4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXJ1
Entrez