TEAD2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TEAD2 Antibody [NBP2-55789] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEAD2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDV
Specificity
Specificity of human TEAD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TEAD2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TEAD2 Antibody

  • TEA domain family member 2TEF4ETF
  • TEAD-2
  • TEF-4
  • transcriptional enhancer factor TEF-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NB100-182
Species: Hu, Mu, Rt, Ca, Kg, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP1-84854
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-03047
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00007005-P01
Species: Hu
H00000034-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-77033
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-88101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007004-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TEAD2 Antibody (NBP2-55789) (0)

There are no publications for TEAD2 Antibody (NBP2-55789).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEAD2 Antibody (NBP2-55789) (0)

There are no reviews for TEAD2 Antibody (NBP2-55789). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TEAD2 Antibody (NBP2-55789) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TEAD2 Products

Bioinformatics Tool for TEAD2 Antibody (NBP2-55789)

Discover related pathways, diseases and genes to TEAD2 Antibody (NBP2-55789). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEAD2 Antibody (NBP2-55789)

Discover more about diseases related to TEAD2 Antibody (NBP2-55789).
 

Pathways for TEAD2 Antibody (NBP2-55789)

View related products by pathway.

PTMs for TEAD2 Antibody (NBP2-55789)

Learn more about PTMs related to TEAD2 Antibody (NBP2-55789).
 

Research Areas for TEAD2 Antibody (NBP2-55789)

Find related products by research area.

Blogs on TEAD2

There are no specific blogs for TEAD2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEAD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEAD2
Novus 100% Guarantee