TEAD4 Antibody (5H3)

Images

 
Western Blot: TEAD4 Antibody (5H3) [H00007004-M01] - TEAD4 monoclonal antibody (M01), clone 5H3 Analysis of TEAD4 expression in HeLa.
Western Blot: TEAD4 Antibody (5H3) [H00007004-M01] - Analysis of TEAD4 over-expressed 293 cell line, cotransfected with TEAD4 Validated Chimera RNAi ( Cat # H00007004-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Western Blot: TEAD4 Antibody (5H3) [H00007004-M01] - Analysis of TEAD4 expression in transfected 293T cell line by TEAD4 monoclonal antibody (M01), clone 5H3.Lane 1: TEAD4 transfected lysate(34.2 KDa).Lane 2: ...read more
Immunoprecipitation: TEAD4 Antibody (5H3) [H00007004-M01] - Analysis of TEAD4 transfected lysate using anti-TEAD4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TEAD4 MaxPab rabbit polyclonal ...read more
ELISA: TEAD4 Antibody (5H3) [H00007004-M01] - Detection limit for recombinant GST tagged TEAD4 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IP, RNAi
Clone
5H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TEAD4 Antibody (5H3) Summary

Immunogen
TEAD4 (NP_003204, 151 a.a. - 260 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP
Specificity
TEAD4 - TEA domain family member 4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TEAD4
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation
  • RNA Inhibition
Application Notes
This antibody reactivity against cell lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA. ICC/IF usage reported in scientific literature (PMID: 23195226).
Publications
Read Publications using
H00007004-M01 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23195226). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TEAD4 Antibody (5H3)

  • EFTR-2
  • hRTEF-1B
  • related transcription enhancer factor 1B
  • RTEF1RTEF-1
  • TCF13L1MGC9014
  • TEA domain family member 4TEF3
  • TEAD-4
  • TEF-3
  • TEFR-1
  • Transcription factor 13-like 1
  • Transcription factor RTEF-1
  • transcriptional enhancer factor 1-related
  • transcriptional enhancer factor 3
  • transcriptional enhancer factor TEF-3

Background

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83949
Species: Hu
Applications: IHC, IHC-P
H00007008-T01
Species: Hu
NBP1-81763
Species: Hu
Applications: IHC, IHC-P
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TEAD4 Antibody (H00007004-M01)(4)

Reviews for TEAD4 Antibody (H00007004-M01) (0)

There are no reviews for TEAD4 Antibody (H00007004-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TEAD4 Antibody (H00007004-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEAD4 Products

Bioinformatics Tool for TEAD4 Antibody (H00007004-M01)

Discover related pathways, diseases and genes to TEAD4 Antibody (H00007004-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEAD4 Antibody (H00007004-M01)

Discover more about diseases related to TEAD4 Antibody (H00007004-M01).
 

Pathways for TEAD4 Antibody (H00007004-M01)

View related products by pathway.

PTMs for TEAD4 Antibody (H00007004-M01)

Learn more about PTMs related to TEAD4 Antibody (H00007004-M01).
 

Research Areas for TEAD4 Antibody (H00007004-M01)

Find related products by research area.

Blogs on TEAD4

There are no specific blogs for TEAD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEAD4 Antibody (5H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol TEAD4
Entrez
OMIM
Uniprot