TDRD7 Antibody

Images

 
Western Blot: TDRD7 Antibody [NBP1-98585] - Rat Small Intestine Lysate 1.0ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TDRD7 Antibody Summary

Immunogen
The immunogen for this antibody is Tdrd7 - C-terminal region. Peptide sequence CSDCSIKVTKVDEARGVAYVYLFTPKNFPDPHRSINRQITNADLWKHQKD.
Clonality
Polyclonal
Host
Rabbit
Gene
TDRD7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
122 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TDRD7 Antibody

  • KIAA1529
  • PCTAIRE2-binding protein
  • PCTAIRE2BPTRAP
  • RP11-508D10.1
  • Trap
  • tudor domain containing 7
  • tudor domain-containing protein 7
  • Tudor repeat associator with PCTAIRE 2

Background

Tdrd7 binds to PCTAIRE 2, a Cdc2-related kinase expressed in the terminally differentiated neuron; contains five tudor-like domains; may mediate the regulation of mitochondrial function in the neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB7665
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready

Publications for TDRD7 Antibody (NBP1-98585) (0)

There are no publications for TDRD7 Antibody (NBP1-98585).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDRD7 Antibody (NBP1-98585) (0)

There are no reviews for TDRD7 Antibody (NBP1-98585). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TDRD7 Antibody (NBP1-98585) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TDRD7 Antibody Products

Related Products by Gene

Bioinformatics Tool for TDRD7 Antibody (NBP1-98585)

Discover related pathways, diseases and genes to TDRD7 Antibody (NBP1-98585). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDRD7 Antibody (NBP1-98585)

Discover more about diseases related to TDRD7 Antibody (NBP1-98585).
 

Pathways for TDRD7 Antibody (NBP1-98585)

View related products by pathway.

PTMs for TDRD7 Antibody (NBP1-98585)

Learn more about PTMs related to TDRD7 Antibody (NBP1-98585).

Blogs on TDRD7

There are no specific blogs for TDRD7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDRD7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TDRD7
Uniprot

Customers Who Bought This Also Bought