TDRD7 Antibody

Images

 
Western Blot: TDRD7 Antibody [NBP1-98585] - Rat Small Intestine Lysate 1.0ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

TDRD7 Antibody Summary

Immunogen
The immunogen for this antibody is Tdrd7 - C-terminal region. Peptide sequence CSDCSIKVTKVDEARGVAYVYLFTPKNFPDPHRSINRQITNADLWKHQKD.
Clonality
Polyclonal
Host
Rabbit
Gene
TDRD7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
122 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TDRD7 Antibody

  • KIAA1529
  • PCTAIRE2-binding protein
  • PCTAIRE2BPTRAP
  • RP11-508D10.1
  • Trap
  • tudor domain containing 7
  • tudor domain-containing protein 7
  • Tudor repeat associator with PCTAIRE 2

Background

Tdrd7 binds to PCTAIRE 2, a Cdc2-related kinase expressed in the terminally differentiated neuron; contains five tudor-like domains; may mediate the regulation of mitochondrial function in the neurons.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, Flow-CS
MAB1419
Species: Hu, Rt
Applications: IHC, ICC, ICFlow
H00001513-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB7665
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15034
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4614
Species: Hu
Applications: Flow

Publications for TDRD7 Antibody (NBP1-98585) (0)

There are no publications for TDRD7 Antibody (NBP1-98585).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDRD7 Antibody (NBP1-98585) (0)

There are no reviews for TDRD7 Antibody (NBP1-98585). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TDRD7 Antibody (NBP1-98585) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TDRD7 Antibody Products

Related Products by Gene

Bioinformatics Tool for TDRD7 Antibody (NBP1-98585)

Discover related pathways, diseases and genes to TDRD7 Antibody (NBP1-98585). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDRD7 Antibody (NBP1-98585)

Discover more about diseases related to TDRD7 Antibody (NBP1-98585).
 

Pathways for TDRD7 Antibody (NBP1-98585)

View related products by pathway.

PTMs for TDRD7 Antibody (NBP1-98585)

Learn more about PTMs related to TDRD7 Antibody (NBP1-98585).

Blogs on TDRD7

There are no specific blogs for TDRD7, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol TDRD7
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-98585 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought