TCL1B Antibody - BSA Free

Western Blot: TCL1B Antibody [NBP2-47608] - Analysis in control (vector only transfected HEK293T lysate) and TCL1B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: TCL1B Antibody [NBP2-47608] - Staining of human cell line REH shows localization to cytosol.

Immunohistochemistry: TCL1B Antibody [NBP2-47608] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts, Leydig cells were strongly stained.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TCL1B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCL1B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TCL1B Protein (NBP2-47608PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TCL1B Antibody - BSA Free

• MTCP1-like protein 1
• Oncogene TCL1B
• Oncogene TCL-1B
• SYN-1
• Syncytiotrophoblast-specific protein
• T-cell leukemia/lymphoma 1B
• T-cell leukemia/lymphoma protein 1B
• T-cell lymphoma/leukemia 1B
• TCL1
• TCL1/MTCP1-like protein 1
• TCL1B
• TML1
• TML1TCL1/ MTCP1-like 1

Background

Enhances the phosphorylation and activation of AKT1 and AKT2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCL1B