TCL1B Antibody

Images

 
Western Blot: TCL1B Antibody [NBP2-47608] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: TCL1B Antibody [NBP2-47608] - Staining of human cell line REH shows localization to cytosol.
Immunohistochemistry: TCL1B Antibody [NBP2-47608] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts, Leydig cells were strongly stained.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCL1B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCL1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
TCL1B Protein (NBP2-47608PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCL1B Antibody

  • MTCP1-like protein 1
  • Oncogene TCL1B
  • Oncogene TCL-1B
  • SYN-1
  • Syncytiotrophoblast-specific protein
  • T-cell leukemia/lymphoma 1B
  • T-cell leukemia/lymphoma protein 1B
  • T-cell lymphoma/leukemia 1B
  • TCL1
  • TCL1/MTCP1-like protein 1
  • TCL1B
  • TML1
  • TML1TCL1/ MTCP1-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4847
Species: Hu
Applications: WB, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-58455
Species: Hu
Applications: ICC/IF
H00004068-M01
Species: Hu
Applications: WB, ELISA
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00027130-P02
Species: Hu

Publications for TCL1B Antibody (NBP2-47608) (0)

There are no publications for TCL1B Antibody (NBP2-47608).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCL1B Antibody (NBP2-47608) (0)

There are no reviews for TCL1B Antibody (NBP2-47608). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCL1B Antibody (NBP2-47608) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCL1B Products

Bioinformatics Tool for TCL1B Antibody (NBP2-47608)

Discover related pathways, diseases and genes to TCL1B Antibody (NBP2-47608). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCL1B Antibody (NBP2-47608)

Discover more about diseases related to TCL1B Antibody (NBP2-47608).
 

Pathways for TCL1B Antibody (NBP2-47608)

View related products by pathway.

PTMs for TCL1B Antibody (NBP2-47608)

Learn more about PTMs related to TCL1B Antibody (NBP2-47608).
 

Research Areas for TCL1B Antibody (NBP2-47608)

Find related products by research area.

Blogs on TCL1B

There are no specific blogs for TCL1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCL1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCL1B
Entrez