TCL1B Antibody


Western Blot: TCL1B Antibody [NBP2-47608] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunocytochemistry/ Immunofluorescence: TCL1B Antibody [NBP2-47608] - Staining of human cell line REH shows localization to cytosol.
Immunohistochemistry: TCL1B Antibody [NBP2-47608] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts, Leydig cells were strongly stained.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

TCL1B Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: WQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPE
Specificity of human TCL1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCL1B Protein (NBP2-47608PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TCL1B Antibody

  • MTCP1-like protein 1
  • Oncogene TCL1B
  • Oncogene TCL-1B
  • SYN-1
  • Syncytiotrophoblast-specific protein
  • T-cell leukemia/lymphoma 1B
  • T-cell leukemia/lymphoma protein 1B
  • T-cell lymphoma/leukemia 1B
  • TCL1
  • TCL1/MTCP1-like protein 1
  • TCL1B
  • TML1
  • TML1TCL1/ MTCP1-like 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Species: Hu
Applications: WB
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu

Publications for TCL1B Antibody (NBP2-47608) (0)

There are no publications for TCL1B Antibody (NBP2-47608).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCL1B Antibody (NBP2-47608) (0)

There are no reviews for TCL1B Antibody (NBP2-47608). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCL1B Antibody (NBP2-47608) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for TCL1B Antibody (NBP2-47608)

Discover related pathways, diseases and genes to TCL1B Antibody (NBP2-47608). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCL1B Antibody (NBP2-47608)

Discover more about diseases related to TCL1B Antibody (NBP2-47608).

Pathways for TCL1B Antibody (NBP2-47608)

View related products by pathway.

PTMs for TCL1B Antibody (NBP2-47608)

Learn more about PTMs related to TCL1B Antibody (NBP2-47608).

Research Areas for TCL1B Antibody (NBP2-47608)

Find related products by research area.

Blogs on TCL1B

There are no specific blogs for TCL1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TCL1B Antibody and receive a gift card or discount.


Gene Symbol TCL1B