TCF7L2 Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7L2 (NP_110383). Peptide sequence MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TCF7L2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
65 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for TCF7L2 Antibody - BSA Free
Background
TCF7L2, or TCF4, is a high mobility group (HMG) box-containing transcription factor that plays a key role in the Wnt signaling pathway. TCF7L2 has been implicated in glucose homeostasis through the regulation of pro-glucagon gene expression, which encodes glucagon-like peptide 1 (GLP-1). Genetic variants of TCF7L2 have been linked to type 2 diabetes, and it has specifically been shown to have an important role in the regulation of both 946;-cell survival and function (4). Several splicing isoforms for TCF7L2 have been shown to be differentially expressed in tissues during cancer progression (3), and gene targeting studies indicate that TCF7L2 is required to maintain the crypt stem cells of the small intestine (1, 2).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Publications for TCF7L2 Antibody (NBP3-10972) (0)
There are no publications for TCF7L2 Antibody (NBP3-10972).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TCF7L2 Antibody (NBP3-10972) (0)
There are no reviews for TCF7L2 Antibody (NBP3-10972).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TCF7L2 Antibody (NBP3-10972) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TCF7L2 Products
Research Areas for TCF7L2 Antibody (NBP3-10972)
Find related products by research area.
|
Blogs on TCF7L2