TC-PTP/PTPN2 Antibody


Western Blot: TC-PTP/PTPN2 Antibody [NBP1-60093] - Jurkat cell lysate, concentration 2.5 ug/ml.
Western Blot: TC-PTP/PTPN2 Antibody [NBP1-60093] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 5.0ug/mL, Peptide Concentration: 2.0ug/mL, more

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TC-PTP/PTPN2 Antibody Summary

Synthetic peptides corresponding to PTPN2(protein tyrosine phosphatase, non-receptor type 2) The peptide sequence was selected from the N terminal of PTPN2. Peptide sequence LEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINAS.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PTPN2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TC-PTP/PTPN2 Antibody

  • protein tyrosine phosphatase, non-receptor type 2
  • PTP2
  • PTPN2
  • T-cell protein tyrosine phosphatase
  • T-cell protein-tyrosine phosphatase
  • TC-PTP
  • tyrosine-protein phosphatase non-receptor type 2


PTPN2 is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Epidermal growth factor receptor and the adaptor protein Shc were reported to be substrates of this PTP, which suggested the roles in growth factor mediated cell signaling.The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Epidermal growth factor receptor and the adaptor protein Shc were reported to be substrates of this PTP, which suggested the roles in growth factor mediated cell signaling. Three alternatively spliced variants of this gene, which encode isoforms differing at their extreme C-termini, have been described. The different C-termini are thought to determine the substrate specificity, as well as the cellular localization of the isoforms. Two highly related but distinctly processed pseudogenes that localize to distinct chromosomes have been reported.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB

Publications for TC-PTP/PTPN2 Antibody (NBP1-60093) (0)

There are no publications for TC-PTP/PTPN2 Antibody (NBP1-60093).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TC-PTP/PTPN2 Antibody (NBP1-60093) (0)

There are no reviews for TC-PTP/PTPN2 Antibody (NBP1-60093). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TC-PTP/PTPN2 Antibody (NBP1-60093) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TC-PTP/PTPN2 Products

Bioinformatics Tool for TC-PTP/PTPN2 Antibody (NBP1-60093)

Discover related pathways, diseases and genes to TC-PTP/PTPN2 Antibody (NBP1-60093). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TC-PTP/PTPN2 Antibody (NBP1-60093)

Discover more about diseases related to TC-PTP/PTPN2 Antibody (NBP1-60093).

Pathways for TC-PTP/PTPN2 Antibody (NBP1-60093)

View related products by pathway.

PTMs for TC-PTP/PTPN2 Antibody (NBP1-60093)

Learn more about PTMs related to TC-PTP/PTPN2 Antibody (NBP1-60093).

Blogs on TC-PTP/PTPN2

There are no specific blogs for TC-PTP/PTPN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TC-PTP/PTPN2 Antibody and receive a gift card or discount.


Gene Symbol PTPN2