TBLR1 Antibody - BSA Free

Western Blot: TBLR1 Antibody [NBP2-94126] - Western blot analysis of extracts of K-562 cells, using TBLR1 antibody (NBP2-94126) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunocytochemistry/Immunofluorescence: TBLR1 Antibody [NBP2-94126] - Immunofluorescence analysis of A549 cells using TBLR1 antibody (NBP2-94126).

Western Blot: TBLR1 Antibody [NBP2-94126] - Western blot analysis of extracts of Mouse brain, using TBLR1 antibody (NBP2-94126) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TBLR1 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-170 of human TBLR1 (NP_078941.2). QQGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHES
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBL1XR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for TBLR1 Antibody - BSA Free

• C21
• DC42
• F-box-like/WD repeat-containing protein TBL1XR1
• FLJ12894
• IRA1Transducin beta-like 1X-related protein 1
• Nuclear receptor corepressor/HDAC3 complex subunit TBLR1
• nuclear receptor co-repressor/HDAC3 complex subunit
• TBLR1TBL1-related protein 1
• transducin (beta)-like 1 X-linked receptor 1
• transducin (beta)-like 1X-linked receptor 1

Background

TBLR1 is encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TBL1XR1