TBK1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVV |
| Predicted Species |
Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TBK1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TBK1 Antibody - BSA Free
Background
NFkappaB-activating kinase (NAK) also known as TANK binding kinase-1 (TBK1) or tumor necrosis factor receptor associated factor 2-associated kinase (T2K) is a serine/threonine protein that belongs to the IkB kinase (IKK) family (1). Similar to IKK alpha and beta (2), NAK induces IkB degradation and NF-kB activity. NAK is activated by phorbol ester tumour promoters and growth factors, whereas catalytically inactive NAK specifically inhibits activation of NF-kB by protein kinase C-epsilon (PKCepsilon). NAK specifically phosphorylates IkB alpha on Serine 36 and NFkB subunit RelA (p65) on Serine 536 (3). NAK is also known to interact with TANK, TRAF-2 and TRIF (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
Publications for TBK1 Antibody (NBP2-55777) (0)
There are no publications for TBK1 Antibody (NBP2-55777).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TBK1 Antibody (NBP2-55777) (0)
There are no reviews for TBK1 Antibody (NBP2-55777).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TBK1 Antibody (NBP2-55777). (Showing 1 - 6 of 6 FAQ).
-
What is the exact sequence this TBK1 antibody recognizes?
- The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.
-
I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?
- While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.
-
We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?
- Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.
-
Is there a smaller size of your TBK1 antibody?
- This TBK1 antibody is offered in a smaller 0.025 mg size.
-
Are there any publications where this TBK1 antibody was used in western blot for mouse?
- This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301
-
Cant this TBK1 antibody be conjugated to PE for FLOW?
- Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.