TBK1 Antibody


Immunocytochemistry/ Immunofluorescence: TBK1 Antibody [NBP2-13416] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TBK1 Antibody [NBP2-13416] - Staining of human testis shows moderate cytoplasmic, membranous and nuclear positivity in cells in seminiferus ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TBK1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHT MTPIYPSSNTLVEMTLGMKKLKEEMEGVVK
Specificity of human TBK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TBK1 Protein (NBP2-13416PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TBK1 Antibody

  • EC 2.7.11
  • EC
  • FLJ11330
  • NAK serine/threonine-protein kinase TBK 1
  • NAKserine/threonine-protein kinase TBK1
  • NF-kappa-B-activating kinase
  • T2K
  • TANK-binding kinase 1NF-kB-activating kinase
  • TBK 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, Single Cell Western
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TBK1 Antibody (NBP2-13416) (0)

There are no publications for TBK1 Antibody (NBP2-13416).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBK1 Antibody (NBP2-13416) (0)

There are no reviews for TBK1 Antibody (NBP2-13416). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TBK1 Antibody (NBP2-13416). (Showing 1 - 6 of 6 FAQ).

  1. What is the exact sequence this TBK1 antibody recognizes?
    • The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.
  2. I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?
    • While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.
  3. We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?
    • Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.
  4. Is there a smaller size of your TBK1 antibody?
    • This TBK1 antibody is offered in a smaller 0.025 mg size.
  5. Are there any publications where this TBK1 antibody was used in western blot for mouse?
    • This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301
  6. Cant this TBK1 antibody be conjugated to PE for FLOW?
    • Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

Secondary Antibodies


Isotype Controls

Additional TBK1 Products

Bioinformatics Tool for TBK1 Antibody (NBP2-13416)

Discover related pathways, diseases and genes to TBK1 Antibody (NBP2-13416). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBK1 Antibody (NBP2-13416)

Discover more about diseases related to TBK1 Antibody (NBP2-13416).

Pathways for TBK1 Antibody (NBP2-13416)

View related products by pathway.

PTMs for TBK1 Antibody (NBP2-13416)

Learn more about PTMs related to TBK1 Antibody (NBP2-13416).

Research Areas for TBK1 Antibody (NBP2-13416)

Find related products by research area.

Blogs on TBK1.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TBK1 Antibody and receive a gift card or discount.


Gene Symbol TBK1