TAZ/WWTR1 Antibody (CL0371)

Images

 
Genetic Strategies: Western Blot: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-WWTR1 antibody. Remaining ...read more
Immunocytochemistry/ Immunofluorescence: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining in SKMEL cell line with Anti-WWTR1 monoclonal antibody, showing spotty nuclear staining in green. Microtubule probes are ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining in human placenta and lymph node tissues. Corresponding WWTR1 RNA-seq data are presented for the same ...read more
Western Blot: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Lane 1: Marker [kDa], Lane 2: Human cell line U-251 MG
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human breast cancer shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human placenta shows strong nuclear and some cytoplasmic positivity in endothelial cells.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human kidney shows strong nuclear and moderate cytoplasmic positivity in cells in tubules and in glomeruli.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody (CL0371) [NBP2-52926] - Staining of human lymph node shows no nuclear positivity in lymphoid cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clone
CL0371
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TAZ/WWTR1 Antibody (CL0371) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Epitope
SSWRKKILPESFFKE
Specificity
Specificity of human TAZ/WWTR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
WWTR1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAZ/WWTR1 Recombinant Protein Antigen (NBP2-52926PEP)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for TAZ/WWTR1 Antibody (CL0371)

  • FLJ27004
  • FLJ45718
  • TAZ
  • TAZDKFZp586I1419
  • transcriptional co-activator with PDZ-binding motif
  • Transcriptional coactivator with PDZ-binding motif
  • WW domain containing transcription regulator 1
  • WW domain-containing transcription regulator protein 1
  • WWTR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
NBP1-81763
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IF
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NB200-197
Species: Hu, Mu
Applications: WB, IP
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
MAB7940
Species: Hu
Applications: WB, IHC
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF
H00154796-B01P
Species: Hu
Applications: WB
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
H00011155-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP, RNAi, S-ELISA
NBP1-89133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TAZ/WWTR1 Antibody (NBP2-52926) (0)

There are no publications for TAZ/WWTR1 Antibody (NBP2-52926).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAZ/WWTR1 Antibody (NBP2-52926) (0)

There are no reviews for TAZ/WWTR1 Antibody (NBP2-52926). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAZ/WWTR1 Antibody (NBP2-52926). (Showing 1 - 1 of 1 FAQ).

  1. I want to know which TAZ primary antibody is best produced for WB (human and mouse)!
    • I would recommend this TAZ antibody: NB110-58359. This is also comes in a sample size.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAZ/WWTR1 Products

Bioinformatics Tool for TAZ/WWTR1 Antibody (NBP2-52926)

Discover related pathways, diseases and genes to TAZ/WWTR1 Antibody (NBP2-52926). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAZ/WWTR1 Antibody (NBP2-52926)

Discover more about diseases related to TAZ/WWTR1 Antibody (NBP2-52926).
 

Pathways for TAZ/WWTR1 Antibody (NBP2-52926)

View related products by pathway.

PTMs for TAZ/WWTR1 Antibody (NBP2-52926)

Learn more about PTMs related to TAZ/WWTR1 Antibody (NBP2-52926).
 

Research Areas for TAZ/WWTR1 Antibody (NBP2-52926)

Find related products by research area.

Blogs on TAZ/WWTR1

There are no specific blogs for TAZ/WWTR1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAZ/WWTR1 Antibody (CL0371) and receive a gift card or discount.

Bioinformatics

Gene Symbol WWTR1