Tau Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: Tau Antibody [NBP2-49603] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Tau Antibody [NBP2-49603] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli and moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Tau Antibody [NBP2-49603] -Staining of human fallopian tube shows negative positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Tau Antibody [NBP2-49603] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Tau Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Tau Antibody - BSA Free (NBP2-49603) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAPT
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tau Recombinant Protein Antigen (NBP2-49603PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Tau Antibody - BSA Free

  • DDPAC
  • FLJ31424
  • FTDP-17
  • G protein beta1/gamma2 subunit-interacting factor 1
  • MAPT
  • MGC138549
  • microtubule-associated protein tau
  • MSTD
  • MSTDMAPTL
  • MTBT1
  • MTBT1Neurofibrillary tangle protein
  • MTBT2
  • Neurofibrillary tangle protein
  • PHF-tau
  • PPND
  • Tau
  • TAUPaired helical filament-tau

Background

Tau is a microtubule binding protein that promotes microtubule assembly and stability. Tau is found to be the major component of the paired helical filaments (PHFs) found in the brains of patients with Alzheimer disease (AD) (1,2). Tau is hyperphosphorylated in PHFs, and specific phosphorylation sites have been implicated in the loss of Tau's association with the membrane cortex during AD disease state, including Ser 199/202, Thr 231, and Ser 393/404 (3). Glycogen synthase kinase-3, or GSK-3, phosphorylates Tau on Ser 396 (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-42388
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-37602
Species: Hu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-74510
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, S-ELISA, WB
NB300-213
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-05513
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49603
Species: Hu
Applications: IHC

Publications for Tau Antibody (NBP2-49603) (0)

There are no publications for Tau Antibody (NBP2-49603).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tau Antibody (NBP2-49603) (0)

There are no reviews for Tau Antibody (NBP2-49603). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tau Antibody (NBP2-49603) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tau Products

Research Areas for Tau Antibody (NBP2-49603)

Find related products by research area.

Blogs on Tau.

HIV-associated neurocognitive disorders involve extracellular Nef-induced modification of lipid rafts and redistribution of Alzheimer’s disease-related proteins
Jamshed Arslan, Pharm D, PhD Cholesterol is an essential part of animal cell membranes. Cholesterol-rich lipid rafts maintain the fluidity and protein trafficking of plasma membranes. Cellular ABCA1 protein moves cho...  Read full blog post.

The C99 fragment of amyloid precursor protein (APP)
Alzheimer’s Disease (AD) is a neurodegenerative disorder that is characterized by an abundance of the beta-amyloid peptide in the brain.  When AD was first discovered, it was determined that beta-amyloid was produced as a result of the prote...  Read full blog post.

Tau - A microtubule associated protein as a biomarker for Alzheimer's disease
The tau protein is a microtubule associated protein found mostly in neuronal cells where it regulates the stability of axonal microtubules as well as kinesin-dependent transport. Tau is relevant in the study of various neurological disorders as ab...  Read full blog post.

PINK1: All work and no fun
The protein PINK1 is a mitochondrial-located serine/threonine kinase (PTK) that maintains organelle function and integrity. It not only protects organelles from cellular stress, but it also uses the selective auto-phagocytosis process for cleaning and...  Read full blog post.

Using Amyloid beta peptides in Alzheimer's Disease Immunization
Amyloid beta (AB) peptide has a central role in the neurodegeneration of Alzheimer's disease (AD). Immunization of AD transgenic mice with AB-42 peptide reduces both the spatial memory impairments and AD-like neuropathologic changes.Therapeutic im...  Read full blog post.

New Study Links Tau Mutations to Microglial Immune Response
Tau proteins are abundant in the axons of neurons in the central nervous system (CNS), and play a key role in microtubule formation and stabilization. Antibody studies have identified six tau isoforms, all produced by alternative mRNA splicing of the ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tau Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPT