Immunocytochemistry/ Immunofluorescence: TATA binding protein TBP Antibody [NBP2-38610] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry: TATA binding protein TBP Antibody [NBP2-38610] - Staining of human testis shows weak nuclear positivity in cells in seminiferous ducts and Leydig cells.
ChIP-Exo-Seq composite graph for Anti-TBP (NBP2-38610) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a ...read more
TATA binding protein TBP Antibody - BSA Free Summary
Description
Novus Biologicals Rabbit TATA binding protein TBP Antibody - BSA Free (NBP2-38610) is a polyclonal antibody validated for use in IHC, ELISA and ICC/IF. Anti-TATA binding protein TBP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for TATA binding protein TBP Antibody - BSA Free
GTF2D
GTF2D1
HDL4
MGC126054
MGC126055
SCA17
TATA box binding protein
TATA sequence-binding protein
TATA-binding factor
TATA-box binding protein N-terminal domain
TATA-box factor
TATA-box-binding protein
TF2D
TFIIDMGC117320
Transcription initiation factor TFIID TBP subunit
Background
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein TBP and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. A distinctive feature of TBP is a long string of glutamines in the N-terminal. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease.TPB is also known to interact with HIV1 Tat protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for TATA binding protein TBP Antibody (NBP2-38610) (0)
There are no reviews for TATA binding protein TBP Antibody (NBP2-38610).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our TATA binding protein TBP Antibody - BSA Free and receive a gift card or discount.