RAP30 Antibody (3T7Q9)

Western Blot: RAP30 Antibody (3T7Q9) [NBP3-15275] - Western blot analysis of extracts of various cell lines, using RAP30 antibody (NBP3-15275) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry of paraffin-embedded rat testis using RAP30 Rabbit mAb (NBP3-15275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry of paraffin-embedded human esophageal using RAP30 Rabbit mAb (NBP3-15275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry of paraffin-embedded mouse kidney using RAP30 Rabbit mAb (NBP3-15275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry analysis of RAP30 in paraffin-embedded human colon tissue using RAP30 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry analysis of RAP30 in paraffin-embedded human lung tissue using RAP30 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry analysis of RAP30 in paraffin-embedded human esophagus tissue using RAP30 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry analysis of RAP30 in paraffin-embedded mouse testis tissue using RAP30 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry analysis of RAP30 in paraffin-embedded rat colon tissue using RAP30 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 3T7Q9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

RAP30 Antibody (3T7Q9) Summary

• Description: Novus Biologicals Rabbit RAP30 Antibody (3T7Q9) (NBP3-15275) is a recombinant monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAP30 (P13984). MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: GTF2F2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RAP30 Antibody (3T7Q9)

• ATP-dependent helicase GTF2F2
• BTF4
• General transcription factor IIF 30 kDa subunit
• general transcription factor IIF subunit 2
• general transcription factor IIF, polypeptide 2, 30kDa
• TF2F2
• TFIIF
• TFIIF-beta
• Transcription initiation factor IIF subunit beta
• Transcription initiation factor RAP30

Background

Predicted to enable RNA polymerase II general transcription initiation factor activity. Involved in transcription by RNA polymerase II. Located in microtubule cytoskeleton and nucleoplasm. Part of transcription preinitiation complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GTF2F2