GTF2A2 Antibody

Images

 
Western Blot: GTF2A2 Antibody [NBP2-55408] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: GTF2A2 Antibody [NBP2-55408] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GTF2A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GTF2A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GTF2A2 Recombinant Protein Antigen (NBP2-55408PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GTF2A2 Antibody

  • General transcription factor IIA subunit 2
  • general transcription factor IIA, 2 (12kD subunit)
  • general transcription factor IIA, 2, 12kDa
  • HsT18745
  • TF2A2
  • TFIIA p12 subunit
  • TFIIA
  • TFIIA-12
  • TFIIA-gamma
  • TFIIAS
  • Transcription initiation factor IIA gamma chain
  • transcription initiation factor IIA subunit 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-32622
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31133
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP3-17973
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NB100-61060
Species: Hu, Mu, V-Vi
Applications: ChIP, IP, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBL1-11392
Species: Hu
Applications: WB
NBP2-87539
Species: Hu
Applications: IHC, IHC-P, WB
H00011036-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-47480
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56506
Species: Ma, Hu, Mar, Mu, Rt
Applications: ChIP, CyTOF-ready, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Simple Western, WB
AF1334
Species: Hu
Applications: IHC, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-55408
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for GTF2A2 Antibody (NBP2-55408) (0)

There are no publications for GTF2A2 Antibody (NBP2-55408).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2A2 Antibody (NBP2-55408) (0)

There are no reviews for GTF2A2 Antibody (NBP2-55408). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GTF2A2 Antibody (NBP2-55408) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GTF2A2 Products

Bioinformatics Tool for GTF2A2 Antibody (NBP2-55408)

Discover related pathways, diseases and genes to GTF2A2 Antibody (NBP2-55408). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF2A2 Antibody (NBP2-55408)

Discover more about diseases related to GTF2A2 Antibody (NBP2-55408).
 

Pathways for GTF2A2 Antibody (NBP2-55408)

View related products by pathway.

Blogs on GTF2A2

There are no specific blogs for GTF2A2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GTF2A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2A2