BRF1 Antibody - BSA Free

Western Blot: BRF1 Antibody [NBP2-55335] - Analysis in human cell line SCLC-21H.

Immunocytochemistry/Immunofluorescence: BRF1 Antibody [NBP2-55335] - Staining of human cell line MCF7 shows localization to nucleoplasm & nuclear bodies.

• Reactivity: Hu
• Applications: WB, ICC/IF, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BRF1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDGSTEDTASSLCGEEDTEDEELEAAASHLNKDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BRF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BRF1 Recombinant Protein Antigen (NBP2-55335PEP)

Reactivity Notes

Mouse (88%), Rat (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BRF1 Antibody - BSA Free

• B-related factor 1
• BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae)
• BRF-1
• BRFFLJ42674
• general transcription factor IIIB, 90kD subunit
• GTF3BTAFIII90
• hBRFMGC105048
• hTFIIIB90
• TAF3B2
• TAF3CB - related factor 1
• TATA box binding protein (TBP)-associated factor 3C
• TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2
• TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2
• TATA box-binding protein-associated factor, RNA polymerase III, subunit 2
• TBP - associated factor, RNA polymerase III, 90kD
• TF3B90
• TFIIIB90FLJ43034
• transcription factor IIIB 90 kDa subunit

Background

BRF1 encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BRF1