TAK1 Antibody

Images

 
Immunohistochemistry-Paraffin: TAK1 Antibody [NBP1-87819] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP3K7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TAK1 Protein (NBP1-87819PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAK1 Antibody

  • EC 2.7.11
  • EC 2.7.11.25
  • MAP3K7
  • MEKK7
  • mitogen-activated protein kinase kinase kinase 7
  • TAK1
  • TAK1/MAP3K7
  • TAK1TGF1a
  • TGF1a
  • TGF-beta activated kinase 1
  • TGF-beta-activated kinase 1
  • Transforming growth factor-beta-activated kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-26506
Species: Hu, Mu, Rt
AF3578
Species: Hu, Mu
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46200
Species: Hu, Mu
Applications: WB, IP
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87819
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for TAK1 Antibody (NBP1-87819) (0)

There are no publications for TAK1 Antibody (NBP1-87819).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAK1 Antibody (NBP1-87819) (0)

There are no reviews for TAK1 Antibody (NBP1-87819). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TAK1 Antibody (NBP1-87819) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAK1 Products

Bioinformatics Tool for TAK1 Antibody (NBP1-87819)

Discover related pathways, diseases and genes to TAK1 Antibody (NBP1-87819). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAK1 Antibody (NBP1-87819)

Discover more about diseases related to TAK1 Antibody (NBP1-87819).
 

Pathways for TAK1 Antibody (NBP1-87819)

View related products by pathway.

PTMs for TAK1 Antibody (NBP1-87819)

Learn more about PTMs related to TAK1 Antibody (NBP1-87819).
 

Research Areas for TAK1 Antibody (NBP1-87819)

Find related products by research area.

Blogs on TAK1

There are no specific blogs for TAK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K7
Entrez