TAK1 Antibody - BSA Free

TAK1 Antibody [NBP1-87819] -Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

TAK1 Antibody [NBP1-87819] -Staining of human breast shows strong cytoplasmic positivity in glandular cells.

TAK1 Antibody [NBP1-87819] -Staining of human fallopian tube shows strong positivity in cilia in trophoblastic cells.

TAK1 Antibody [NBP1-87819] -Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-MAP3K7 (NBP1-87819) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TAK1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLS
• Predicted Species: Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAP3K7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation Sequencing 1-10µg per reaction
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TAK1 Protein (NBP1-87819PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TAK1 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.25
• MAP3K7
• MEKK7
• mitogen-activated protein kinase kinase kinase 7
• TAK1
• TAK1/MAP3K7
• TAK1TGF1a
• TGF1a
• TGF-beta activated kinase 1
• TGF-beta-activated kinase 1
• Transforming growth factor-beta-activated kinase 1

Background

TAK1 (or MAP3K7) was shown to participate in regulation of transcription by transforming growth factor beta (TGF beta). TAK1 is stimulated in response to TGF beta and bone morphogenetic protein. These results suggest that TAK1 functions as a mediator in the signaling pathway of TGF beta superfamily members. TAB1 and TAB2 are TAK1 binding proteins that may function as activators of the TAK1 (TGF b activated kinase 1) MAPKKK in TGF b signal transduction. TAB1 induced TAK1 activation promoted the dissociation of active forms of IKKa and IKK b from active TAK1, whereas the IKK mutants remained to interact with active TAK1. TNF a activated endogenous TAK1, and the kinase negative TAK1 acted as a dominant negative inhibitor against TNF a induced NFkB activation. TAK1 was suggested to act as a regulatory kinase of IKKs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TAK1 Antibody (NBP1-87819)(1)

Publication using NBP1-87819

• Wang JH, Lin FL, Chen J et al. TAK1 blockade as a therapy for retinal neovascularization Pharmacological research 2022-12-16 [PMID: 36535572] (IF/IHC, Rat)
  
  Details:
  Dilution used in IHC 1:100

Bioinformatics

• Gene Symbol: MAP3K7