TAGAP Antibody - BSA Free

Western Blot: TAGAP Antibody [NBP2-88407] - WB Suggested Anti-TAGAP Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Liver

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TAGAP Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of TAGAP. Peptide sequence: PRPNLLLLKHLVYVLHLISKNSEVNRMDSSNLAICIGPNMLTLENDQSLS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAGAP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TAGAP Antibody - BSA Free

• FLJ32631
• FLJ39771
• IDDM21
• MGC133247
• MGC27381
• TAGAP1
• T-cell activation GTPase activating protein
• T-cell activation GTPase-activating protein
• T-cell activation Rho GTPase-activating protein
• T-cell activation RhoGTPase activating protein

Background

TAGAP encodes a protein that may function as a Rho GTPase-activating protein. Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAGAP