TAF5L Antibody

Images

 
Western Blot: TAF5L Antibody [NBP2-57546] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: TAF5L Antibody [NBP2-57546] - Staining of human cell line U-251 MG shows localization to nuclear speckles. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAF5L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP
Specificity
Specificity of human TAF5L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF5L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAF5L Recombinant Protein Antigen (NBP2-57546PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TAF5L Antibody

  • PAF65B
  • PAF65BPAF65-beta
  • PCAF associated factor 65 beta
  • PCAF-associated factor 65 beta
  • TAF5L
  • TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 5L
  • TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD
  • TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88309
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76307
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB5285
Species: Hu
Applications: WB, Simple Western
H00008543-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31896
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-80355
Species: Hu
Applications: WB, IHC, IHC-P, ChIP
H00006932-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-31968
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80268
Species: Mu
Applications: WB
NB100-1720
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-55408
Species: Hu
Applications: WB, ICC/IF
NBP2-57546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for TAF5L Antibody (NBP2-57546) (0)

There are no publications for TAF5L Antibody (NBP2-57546).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF5L Antibody (NBP2-57546) (0)

There are no reviews for TAF5L Antibody (NBP2-57546). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAF5L Antibody (NBP2-57546) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAF5L Products

Bioinformatics Tool for TAF5L Antibody (NBP2-57546)

Discover related pathways, diseases and genes to TAF5L Antibody (NBP2-57546). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF5L Antibody (NBP2-57546)

Discover more about diseases related to TAF5L Antibody (NBP2-57546).
 

Pathways for TAF5L Antibody (NBP2-57546)

View related products by pathway.

Blogs on TAF5L

There are no specific blogs for TAF5L, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF5L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF5L