TAF5 Antibody

Images

 
Western Blot: TAF5 Antibody [NBP1-86971] - Analysis in human cell line U-937 MG.
Immunocytochemistry/ Immunofluorescence: TAF5 Antibody [NBP1-86971] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TAF5 Antibody [NBP1-86971] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells and glial cells.
Western Blot: TAF5 Antibody [NBP1-86971] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAF5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTK
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAF5 Protein (NBP1-86971PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAF5 Antibody

  • TAF(II)100
  • TAF2DTATA box binding protein (TBP)-associated factor 2D
  • TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAFII100TAFII-100
  • TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100kD
  • transcription initiation factor TFIID 100 kD subunit
  • Transcription initiation factor TFIID 100 kDa subunit
  • transcription initiation factor TFIID subunit 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1334
Species: Hu
Applications: IHC, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77847
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, NULL, WB
NBP1-82774
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
H00006879-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
H00006883-M11
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-17017
Species: Hu, Mu
Applications: ICC/IF, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP2-01967
Species: Hu, Mu, Rt
Applications: WB
NBP1-80706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, IP, WB

Publications for TAF5 Antibody (NBP1-86971) (0)

There are no publications for TAF5 Antibody (NBP1-86971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF5 Antibody (NBP1-86971) (0)

There are no reviews for TAF5 Antibody (NBP1-86971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAF5 Antibody (NBP1-86971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAF5 Products

Array NBP1-86971

Bioinformatics Tool for TAF5 Antibody (NBP1-86971)

Discover related pathways, diseases and genes to TAF5 Antibody (NBP1-86971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF5 Antibody (NBP1-86971)

Discover more about diseases related to TAF5 Antibody (NBP1-86971).
 

Pathways for TAF5 Antibody (NBP1-86971)

View related products by pathway.

PTMs for TAF5 Antibody (NBP1-86971)

Learn more about PTMs related to TAF5 Antibody (NBP1-86971).

Blogs on TAF5

There are no specific blogs for TAF5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF5