GRHL3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GRHL3 Antibody [NBP2-57087] - Staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Analysis in human urinary bladder and skeletal muscle tissues. Corresponding GRHL3 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: GRHL3 Antibody [NBP2-57087] - Staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

GRHL3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSL
Specificity
Specificity of human GRHL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRHL3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRHL3 Recombinant Protein Antigen (NBP2-57087PEP)

Reactivity Notes

Mouse 84%, Rat 86%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GRHL3 Antibody

  • grainyhead-like 3 (Drosophila)
  • MGC46624
  • Sister of mammalian grainyhead
  • sister-of-mammalian grainyhead
  • SOMTranscription factor CP2-like 4grainyhead-like protein 3 homolog
  • TFCP2L4
  • transcription factor hSOM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
MAB4077
Species: Hu
Applications: WB, IHC
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC, IHC-FrFl, IHC-WhMt, KO
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-858
Species: Hu, Mu, Rt, Gp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NBP1-45217
Species: Hu, Mu, Rt, Xp
Applications: WB, IHC, IHC-Fr, PEP-ELISA
NBP1-45217
Species: Hu, Mu, Rt, Xp
Applications: WB, IHC, IHC-Fr, PEP-ELISA
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for GRHL3 Antibody (NBP2-57087) (0)

There are no publications for GRHL3 Antibody (NBP2-57087).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRHL3 Antibody (NBP2-57087) (0)

There are no reviews for GRHL3 Antibody (NBP2-57087). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GRHL3 Antibody (NBP2-57087) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GRHL3 Products

Bioinformatics Tool for GRHL3 Antibody (NBP2-57087)

Discover related pathways, diseases and genes to GRHL3 Antibody (NBP2-57087). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRHL3 Antibody (NBP2-57087)

Discover more about diseases related to GRHL3 Antibody (NBP2-57087).
 

Pathways for GRHL3 Antibody (NBP2-57087)

View related products by pathway.

PTMs for GRHL3 Antibody (NBP2-57087)

Learn more about PTMs related to GRHL3 Antibody (NBP2-57087).

Blogs on GRHL3

There are no specific blogs for GRHL3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRHL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRHL3