TAF6 Antibody

Images

 
Western Blot: TAF6 Antibody [NBP1-82774] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: TAF6 Antibody [NBP1-82774] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry: TAF6 Antibody [NBP1-82774] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunocytochemistry/ Immunofluorescence: TAF6 Antibody [NBP1-82774] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: TAF6 Antibody [NBP1-82774] - Staining of human fallopian tube shows moderate nuclear positivity in a subset of glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAF6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDPG
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TAF6 Protein (NBP1-82774PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAF6 Antibody

  • DKFZp781E21155
  • MGC:8964
  • RNA polymerase II, E, 70/85kD
  • TAF(II)70
  • TAF(II)80
  • TAF2ERNA polymerase II TBP-associated factor subunit E
  • TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
  • TAFII70TAFII-80
  • TAFII80TAFII-70
  • TAFII85
  • Transcription initiation factor TFIID 70 kDa subunit
  • Transcription initiation factor TFIID 80 kDa subunit
  • transcription initiation factor TFIID subunit 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61060
Species: Hu, Mu, V-Vi
Applications: ChIP, IP, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP2-87539
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBL1-11392
Species: Hu
Applications: WB
NBP2-41266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF1334
Species: Hu
Applications: IHC, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-67719
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-581
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
AF3296
Species: Hu, Mu, Rt
Applications: WB
NBP3-06477
Species: Hu
Applications: ICC/IF, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-32622
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-314
Species: Hu
Applications: IP, WB

Publications for TAF6 Antibody (NBP1-82774) (0)

There are no publications for TAF6 Antibody (NBP1-82774).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAF6 Antibody (NBP1-82774) (0)

There are no reviews for TAF6 Antibody (NBP1-82774). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAF6 Antibody (NBP1-82774) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAF6 Products

Bioinformatics Tool for TAF6 Antibody (NBP1-82774)

Discover related pathways, diseases and genes to TAF6 Antibody (NBP1-82774). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAF6 Antibody (NBP1-82774)

Discover more about diseases related to TAF6 Antibody (NBP1-82774).
 

Pathways for TAF6 Antibody (NBP1-82774)

View related products by pathway.

PTMs for TAF6 Antibody (NBP1-82774)

Learn more about PTMs related to TAF6 Antibody (NBP1-82774).

Blogs on TAF6

There are no specific blogs for TAF6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAF6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF6