Immunocytochemistry/ Immunofluorescence: TAF10 Antibody [NBP1-80706] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TAF10 Antibody [NBP1-80706] - Staining of human kidney shows distinct nuclear positivity in glomeruli.
ChIP-Exo-Seq composite graph for Anti-TAF10 (NBP1-80706) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a ...read more
Z363 promotes MYC and TAF10 degradation. (A) Identification of small inhibitory molecules for MYC. (B) MCF7 cells were treated with Z363 (0, 2.5, 7.5 and 15 μg/ml) for 24 h. The protein levels of MYC and TAF10 were ...read more
TAF10 promotes cancer cell proliferation and migration. (A and B) MCF7 cells were transfected with Flag‐labelled MYC and HA‐labelled TAF10, and the interaction between MYC and TAF10 was detected by Co‐IP. (C) ...read more
Z363 promotes MYC and TAF10 degradation. (A) Identification of small inhibitory molecules for MYC. (B) MCF7 cells were treated with Z363 (0, 2.5, 7.5 and 15 μg/ml) for 24 h. The protein levels of MYC and TAF10 were ...read more
TAF10 plays oncogenic role in LUAD. A mRNA expression levels of the corresponding gene in human normal bronchial epithelial cells (16HBE) and LUAD cell lines. B TAF10 mRNA expression levels in various tumors and matched ...read more
TAF10 promotes cancer cell proliferation and migration. (A and B) MCF7 cells were transfected with Flag‐labelled MYC and HA‐labelled TAF10, and the interaction between MYC and TAF10 was detected by Co‐IP. (C) ...read more
Z363 promotes MYC and TAF10 degradation. (A) Identification of small inhibitory molecules for MYC. (B) MCF7 cells were treated with Z363 (0, 2.5, 7.5 and 15 μg/ml) for 24 h. The protein levels of MYC and TAF10 were ...read more
TAF10 plays oncogenic role in LUAD. A mRNA expression levels of the corresponding gene in human normal bronchial epithelial cells (16HBE) and LUAD cell lines. B TAF10 mRNA expression levels in various tumors and matched ...read more
Co‐inhibition of MYC and TAF10 causes synergistic reduction of cell proliferation and tumour growth. (A) Cells (WT, TAF10 KO) were treated with different doses of Z363 for 24 h. Cell proliferation was determined by ...read more
Novus Biologicals Rabbit TAF10 Antibody - BSA Free (NBP1-80706) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-TAF10 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKP
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the small subunits of TFIID that is associated with a subset of TFIID complexes. Studies with human and mammalian cells have shown that this subunit is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our TAF10 Antibody - BSA Free and receive a gift card or discount.