TACC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TACC1 Antibody [NBP1-89447] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.
Immunohistochemistry-Paraffin: TACC1 Antibody [NBP1-89447] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TACC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TACC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TACC1 Protein (NBP1-89447PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TACC1 Antibody

  • DKFZp686K18126
  • FLJ42304
  • Ga55
  • Gastric cancer antigen Ga55
  • KIAA1103
  • taxin 1
  • taxin-1
  • transforming acidic coiled-coil-containing protein 1
  • transforming, acidic coiled-coil containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46058
Species: Hu
Applications: WB, IHC
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-16610
Species: Hu
Applications: WB
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47745
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-319
Species: Hu
Applications: WB, IP, PLA
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready

Publications for TACC1 Antibody (NBP1-89447) (0)

There are no publications for TACC1 Antibody (NBP1-89447).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TACC1 Antibody (NBP1-89447) (0)

There are no reviews for TACC1 Antibody (NBP1-89447). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TACC1 Antibody (NBP1-89447) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TACC1 Products

TACC1 NBP1-89447

Bioinformatics Tool for TACC1 Antibody (NBP1-89447)

Discover related pathways, diseases and genes to TACC1 Antibody (NBP1-89447). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TACC1 Antibody (NBP1-89447)

Discover more about diseases related to TACC1 Antibody (NBP1-89447).
 

Pathways for TACC1 Antibody (NBP1-89447)

View related products by pathway.

PTMs for TACC1 Antibody (NBP1-89447)

Learn more about PTMs related to TACC1 Antibody (NBP1-89447).

Blogs on TACC1

There are no specific blogs for TACC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TACC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TACC1