TAB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: TAB2 Antibody [NBP2-68833] - Staining of human pancreas shows cytoplasmic positivity in exocrine cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TAB2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TAB2 Antibody - BSA Free (NBP2-68833) is a polyclonal antibody validated for use in IHC. Anti-TAB2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDTEDDEGAQWNC
• Predicted Species: Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAB2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  TAB2 Recombinant Protein Antigen (NBP2-68833PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for TAB2 Antibody - BSA Free

• FLJ21885
• KIAA0733CHTD2
• MAP3K7IP2mitogen-activated protein kinase kinase kinase 7 interacting protein 2
• Mitogen-activated protein kinase kinase kinase 7-interacting protein 2
• TAB-2
• TAK1-binding protein 2
• TGF-beta activated kinase 1/MAP3K7 binding protein 2
• TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
• TGF-beta-activated kinase 1-binding protein 2

Background

TAB2 is encoded by this gene is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of nuclear factor kappaB and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serves as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF-kappB (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TAB2 Antibody (NBP2-68833)(1)

Publication using NBP2-68833

• Han H, Xing J, Chen W et al. Fluorinated polyamidoamine dendrimer-mediated miR-23b delivery for the treatment of experimental rheumatoid arthritis in rats Nature communications 2023-02-20 [PMID: 36805456] (IHC, Rat)

Bioinformatics

• Gene Symbol: TAB2