TR4/NR2C2 Antibody - BSA Free

Western Blot: TR4/NR2C2 Antibody [NBP1-81658] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: TR4/NR2C2 Antibody [NBP1-81658] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Western Blot: TR4/NR2C2 Antibody [NBP1-81658] - Analysis in human cell line HeLa.

Immunohistochemistry-Paraffin: TR4/NR2C2 Antibody [NBP1-81658] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: TR4/NR2C2 Antibody [NBP1-81658] -Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: TR4/NR2C2 Antibody [NBP1-81658] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: TR4/NR2C2 Antibody [NBP1-81658] - Staining of human rectum shows strong nuclear positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-NR2C2 (NBP1-81658) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TR4/NR2C2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TR4/NR2C2 Antibody - BSA Free (NBP1-81658) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NR2C2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control:

  ZIC1 Antibody - BSA Free
  ZIC1 Antibody - BSA Free

• Control Peptide:

  TR4/NR2C2 Protein (NBP1-81658PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TR4/NR2C2 Antibody - BSA Free

• hTAK1
• NR2C2
• Nuclear hormone receptor TR4
• nuclear receptor subfamily 2 group C member 2
• nuclear receptor subfamily 2, group C, member 2
• Orphan nuclear receptor TAK1
• Orphan nuclear receptor TR4
• TAK1
• TAK1TR4TR2R1
• Testicular receptor 4
• TR4 nuclear hormone receptor
• TR4

Background

TR4 (TAK1, NR2C2) is an orphan nuclear receptor. TR4 was originally cloned from lymphoblastoma Raji cells or mouse brain cDNA library. No ligand has been reported. Northern blot shows TR4 is transcribed as a 9kb mRNA in many tissues and as a 2.8kb mRNA in testis, mainly in spermatocytes. TR4 has two isoforms called TR4alpha1 and TR4 alpha2,which differ in 19 amino acids coded by two separate exons. Both products translated from the 9kb transcript are ubiquitously expressed. Since TR4 binds to the same elements for the RAR-RXR or TR-RXR heterodimers, TR4 may have an inhibitory effect for retinoic-acid mediated transactivation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NR2C2