Syntaxin 8 Antibody

Images

 
Western Blot: Syntaxin 8 Antibody [NBP1-91152] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: Syntaxin 8 Antibody [NBP1-91152] - Staining of human heart muscle shows strong cytoplasmic and nuclear positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syntaxin 8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STX8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Syntaxin 8 Protein (NBP1-91152PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Syntaxin 8 Antibody

  • CARB
  • CIP-1-associated regulator of cyclin B
  • STX8
  • Syntaxin 8
  • syntaxin-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87497
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5354
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
MAB6117
Species: Hu
Applications: WB, IHC
NBP2-04611
Species: Hu
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA

Publications for Syntaxin 8 Antibody (NBP1-91152) (0)

There are no publications for Syntaxin 8 Antibody (NBP1-91152).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin 8 Antibody (NBP1-91152) (0)

There are no reviews for Syntaxin 8 Antibody (NBP1-91152). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Syntaxin 8 Antibody (NBP1-91152) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin 8 Products

Bioinformatics Tool for Syntaxin 8 Antibody (NBP1-91152)

Discover related pathways, diseases and genes to Syntaxin 8 Antibody (NBP1-91152). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin 8 Antibody (NBP1-91152)

Discover more about diseases related to Syntaxin 8 Antibody (NBP1-91152).
 

Pathways for Syntaxin 8 Antibody (NBP1-91152)

View related products by pathway.

PTMs for Syntaxin 8 Antibody (NBP1-91152)

Learn more about PTMs related to Syntaxin 8 Antibody (NBP1-91152).
 

Research Areas for Syntaxin 8 Antibody (NBP1-91152)

Find related products by research area.

Blogs on Syntaxin 8

There are no specific blogs for Syntaxin 8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaxin 8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STX8
Entrez