Syntaxin 16 Antibody (5H6D5)

Western Blot: Syntaxin 16 Antibody (5H6D5) [NBP3-16810] - Western blot analysis of extracts of various cell lines, using (NBP3-16810) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry: Syntaxin 16 Antibody (5H6D5) [NBP3-16810] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Syntaxin 16 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Syntaxin 16 Antibody (5H6D5) [NBP3-16810] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using Syntaxin 16 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Syntaxin 16 Antibody (5H6D5) [NBP3-16810] - Immunohistochemistry analysis of paraffin-embedded Human small intestine tissue using Syntaxin 16 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Syntaxin 16 Antibody (5H6D5) [NBP3-16810] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Syntaxin 16 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 5H6D5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Syntaxin 16 Antibody (5H6D5) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin 16 (O14662). MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELA
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: STX16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:100 - 1:500

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Syntaxin 16 Antibody (5H6D5)

• MGC90328
• STX16
• Syn16
• SYN16hsyn16
• Syntaxin 16
• syntaxin-16

Background

Syntaxin 16 is a SNARE involved in a vesicular transport step within the Golgi stack. It is ubiquitously expressed in Drosophila and localizes to the Golgi apparatus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STX16