Syntaxin 12 Antibody

Images

 
Western Blot: Syntaxin 12 Antibody [NBP1-86985] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: Syntaxin 12 Antibody [NBP1-86985] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.
Western Blot: Syntaxin 12 Antibody [NBP1-86985] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Syntaxin 12 Antibody [NBP1-86985] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syntaxin 12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSYGPLDVYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKETNELLKE
Marker
Early Endosomes Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STX12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Syntaxin 12 Protein (NBP1-86985PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Syntaxin 12 Antibody

  • MGC51957
  • STX12
  • STX13
  • STX14
  • Syntaxin 12
  • syntaxin-12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74392
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92467
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB6117
Species: Hu
Applications: WB, IHC
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87497
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5664
Species: Hu
Applications: WB, IHC, ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-15131
Species: Hu
Applications: WB
AF5320
Species: Hu
Applications: WB
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51599
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Syntaxin 12 Antibody (NBP1-86985) (0)

There are no publications for Syntaxin 12 Antibody (NBP1-86985).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syntaxin 12 Antibody (NBP1-86985) (0)

There are no reviews for Syntaxin 12 Antibody (NBP1-86985). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Syntaxin 12 Antibody (NBP1-86985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syntaxin 12 Products

Bioinformatics Tool for Syntaxin 12 Antibody (NBP1-86985)

Discover related pathways, diseases and genes to Syntaxin 12 Antibody (NBP1-86985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syntaxin 12 Antibody (NBP1-86985)

Discover more about diseases related to Syntaxin 12 Antibody (NBP1-86985).
 

Pathways for Syntaxin 12 Antibody (NBP1-86985)

View related products by pathway.

Research Areas for Syntaxin 12 Antibody (NBP1-86985)

Find related products by research area.

Blogs on Syntaxin 12

There are no specific blogs for Syntaxin 12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syntaxin 12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STX12
Entrez