Syndecan-2/CD362 Antibody (1B2)

Images

 
Sandwich ELISA: Syndecan-2 Antibody (1B2) [H00006383-M04] - Detection limit for recombinant GST tagged SDC2 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Syndecan-2/CD362 Antibody (1B2) Summary

Immunogen
SDC2 (NP_002989.2, 32 a.a. - 130 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNV
Specificity
Reacts with syndecan 2.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SDC2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Syndecan-2/CD362 Antibody (1B2)

  • CD362 antigen
  • CD362
  • Fibroglycan
  • heparan sulfate proteoglycan 1, cell surface-associated
  • Heparan sulfate proteoglycan core protein
  • HSPG
  • HSPG1
  • HSPG1syndecan proteoglycan 2
  • SDC2
  • SYND2
  • SYND2cell surface-associated heparan sulfate proteoglycan 1
  • syndecan 2
  • Syndecan2
  • Syndecan-2

Background

The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2918
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2119
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-33197
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF143
Species: Hu
Applications: WB, Simple Western, IHC
232-FA/CF
Species: Hu
7570-GH
Species: Hu
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for Syndecan-2/CD362 Antibody (H00006383-M04) (0)

There are no publications for Syndecan-2/CD362 Antibody (H00006383-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syndecan-2/CD362 Antibody (H00006383-M04) (0)

There are no reviews for Syndecan-2/CD362 Antibody (H00006383-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Syndecan-2/CD362 Antibody (H00006383-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syndecan-2/CD362 Products

Bioinformatics Tool for Syndecan-2/CD362 Antibody (H00006383-M04)

Discover related pathways, diseases and genes to Syndecan-2/CD362 Antibody (H00006383-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syndecan-2/CD362 Antibody (H00006383-M04)

Discover more about diseases related to Syndecan-2/CD362 Antibody (H00006383-M04).
 

Pathways for Syndecan-2/CD362 Antibody (H00006383-M04)

View related products by pathway.

PTMs for Syndecan-2/CD362 Antibody (H00006383-M04)

Learn more about PTMs related to Syndecan-2/CD362 Antibody (H00006383-M04).
 

Research Areas for Syndecan-2/CD362 Antibody (H00006383-M04)

Find related products by research area.

Blogs on Syndecan-2/CD362

There are no specific blogs for Syndecan-2/CD362, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syndecan-2/CD362 Antibody (1B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol SDC2
Entrez
Uniprot