Syncollin Antibody


Immunohistochemistry-Paraffin: Syncollin Antibody [NBP2-13402] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: Syncollin Antibody [NBP2-13402] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Syncollin Antibody [NBP2-13402] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Syncollin Antibody [NBP2-13402] - Staining in human pancreas and colon tissues using anti-SYCN antibody. Corresponding SYCN RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Syncollin Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNA ISALYCRCP
Specificity of human Syncollin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Syncollin Protein (NBP2-13402PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Syncollin Antibody

  • INSSA1
  • insulin synthesis associated 1
  • Insulin synthesis-associated protein 1
  • SYLFLJ27441
  • syncollin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Fe, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Syncollin Antibody (NBP2-13402) (0)

There are no publications for Syncollin Antibody (NBP2-13402).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syncollin Antibody (NBP2-13402) (0)

There are no reviews for Syncollin Antibody (NBP2-13402). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Syncollin Antibody (NBP2-13402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Syncollin Products

Bioinformatics Tool for Syncollin Antibody (NBP2-13402)

Discover related pathways, diseases and genes to Syncollin Antibody (NBP2-13402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syncollin Antibody (NBP2-13402)

Discover more about diseases related to Syncollin Antibody (NBP2-13402).

Pathways for Syncollin Antibody (NBP2-13402)

View related products by pathway.

PTMs for Syncollin Antibody (NBP2-13402)

Learn more about PTMs related to Syncollin Antibody (NBP2-13402).

Blogs on Syncollin

There are no specific blogs for Syncollin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Syncollin Antibody and receive a gift card or discount.


Gene Symbol SYCN