Syncollin Antibody

Images

 
Immunohistochemistry-Paraffin: Syncollin Antibody [NBP2-13402] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syncollin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TASSLVVAPRCELTVWSRQGKAGKTHKFSAGTYPRLEEYRRGILGDWSNA ISALYCRCP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYCN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Syncollin Protein (NBP2-13402PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Syncollin Antibody

  • INSSA1
  • insulin synthesis associated 1
  • Insulin synthesis-associated protein 1
  • SYLFLJ27441
  • syncollin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-27393
Species: Hu, Mu
Applications: WB, Simple Western, IHC-Fr, IHC-P, IP
NBP1-32493
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-15131
Species: Hu
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NB120-6588
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Syncollin Antibody (NBP2-13402) (0)

There are no publications for Syncollin Antibody (NBP2-13402).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syncollin Antibody (NBP2-13402) (0)

There are no reviews for Syncollin Antibody (NBP2-13402). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Syncollin Antibody (NBP2-13402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syncollin Products

Bioinformatics Tool for Syncollin Antibody (NBP2-13402)

Discover related pathways, diseases and genes to Syncollin Antibody (NBP2-13402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syncollin Antibody (NBP2-13402)

Discover more about diseases related to Syncollin Antibody (NBP2-13402).
 

Pathways for Syncollin Antibody (NBP2-13402)

View related products by pathway.

PTMs for Syncollin Antibody (NBP2-13402)

Learn more about PTMs related to Syncollin Antibody (NBP2-13402).

Blogs on Syncollin

There are no specific blogs for Syncollin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syncollin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYCN