Synaptotagmin 12 Antibody - Azide and BSA Free

Western Blot: Synaptotagmin 12 Antibody [NBP3-15537] - Analysis of extracts of Mouse brain, using Synaptotagmin 12 Rabbit pAb (NBP3-15537) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunocytochemistry/Immunofluorescence: Synaptotagmin 12 Antibody [NBP3-15537] - Immunofluorescence analysis of L929 cells using Synaptotagmin 12 antibody (NBP3-15537) at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Mu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Synaptotagmin 12 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Synaptotagmin 12 Antibody - Azide and BSA Free (NBP3-15537) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 95-200 of human Synaptotagmin 12 (NP_001171351.1). KGSLSIEDTFESISELGPLELMGRELDLAPYGTLRKSQSADSLNSISSVSNTFGQDFTLGQVEVSMEYDTASHTLNVAVMQGKDLLEREEASFESCFMRVSLLPDE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYT12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Synaptotagmin 12 Antibody - Azide and BSA Free

• SRG1
• synaptotagmin XIIsynaptotagmin-XII
• synaptotagmin-12
• SYT11
• sytXII

Background

May be involved in ca(2+)-dependent exocytosis of secretory vesicles through ca(2+) and phospholipid binding to the c2 domain or may serve as ca(2+) sensors in the process of vesicular trafficking and exocytosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SYT12