SYT7 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining in human cerebral cortex and skeletal muscle tissues . Corresponding SYT7 RNA-seq data are presented for the same ...read more
Western Blot: SYT7 Antibody [NBP1-81588] - Analysis in control (vector only transfected HEK293T lysate) and SYT7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: SYT7 Antibody [NBP1-81588] - Analysis in human cell line SK-BR-3.
Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human prostate shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SYT7 Antibody [NBP1-81588] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SYT7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLP
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYT7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SYT7 Protein (NBP1-81588PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SYT7 Antibody

  • IPCA-7synaptotagmin 7
  • MGC150517
  • prostate cancer associated protein 7
  • Prostate cancer-associated protein 7
  • synaptotagmin VIIPCANAP7
  • synaptotagmin-7
  • sytVII
  • SYT-VII

Background

Synaptotagmins, such as SYT7, are brain-specific calcium-dependent phospholipid-binding proteins that play a role in synaptic exocytosis and neurotransmitter release. See MIM 600782.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91499
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-91297
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
MAB6117
Species: Hu
Applications: IHC, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-52721
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
H00006760-B01P
Species: Hu
Applications: ICC/IF, WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-60112
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-46045
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF1936
Species: Hu
Applications: IP, WB
NBP1-85313
Species: Hu
Applications: IHC, IHC-P, WB

Publications for SYT7 Antibody (NBP1-81588) (0)

There are no publications for SYT7 Antibody (NBP1-81588).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SYT7 Antibody (NBP1-81588) (0)

There are no reviews for SYT7 Antibody (NBP1-81588). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SYT7 Antibody (NBP1-81588) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SYT7 Products

Bioinformatics Tool for SYT7 Antibody (NBP1-81588)

Discover related pathways, diseases and genes to SYT7 Antibody (NBP1-81588). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SYT7 Antibody (NBP1-81588)

Discover more about diseases related to SYT7 Antibody (NBP1-81588).
 

Pathways for SYT7 Antibody (NBP1-81588)

View related products by pathway.

PTMs for SYT7 Antibody (NBP1-81588)

Learn more about PTMs related to SYT7 Antibody (NBP1-81588).
 

Research Areas for SYT7 Antibody (NBP1-81588)

Find related products by research area.

Blogs on SYT7

There are no specific blogs for SYT7, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SYT7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYT7