MCCC1 Antibody

Images

 
Western Blot: MCCC1 Antibody [NBP1-81254] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MCCC1 Antibody [NBP1-81254] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MCCC1 Antibody [NBP1-81254] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCCC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ITGTDLVEWQLRIAAGEKIPLSQEEITLQGHAFEARIYAEDPSNNFMPVAGPLVHLSTPRADPSTRIETGVRQGDEVSVHYDPMIAKLVVWAADRQAALTKLRYSLRQYNIVGLHTNIDFLLNLSGHPEFEAGNVHTDFIPQHH
Specificity
Specificity of human MCCC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MCCC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MCCC1 Protein (NBP1-81254PEP)
Publications
Read Publication using
NBP1-81254 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCCC1 Antibody

  • 3-methylcrotonyl-CoA carboxylase 1
  • DKFZp686B20267
  • EC 6.4.1
  • EC 6.4.1.4
  • MCCAFLJ25545
  • MCC-B
  • methylcrotonoyl-CoA carboxylase 1 (alpha)
  • methylcrotonoyl-Coenzyme A carboxylase 1 (alpha)
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38930
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85885
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB300-206
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IHC-P, IP
NBP2-32398
Species: Hu
Applications: IHC, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce, I, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, KO
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-93989
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002629-M01
Species: Hu, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-59678
Species: Hu
Applications: WB
NBP1-86108
Species: Hu
Applications: WB, IHC, IHC-P
MAB6918
Species: Hu
Applications: WB

Publications for MCCC1 Antibody (NBP1-81254)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MCCC1 Antibody (NBP1-81254) (0)

There are no reviews for MCCC1 Antibody (NBP1-81254). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MCCC1 Antibody (NBP1-81254) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MCCC1 Products

Array NBP1-81254

Bioinformatics Tool for MCCC1 Antibody (NBP1-81254)

Discover related pathways, diseases and genes to MCCC1 Antibody (NBP1-81254). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCCC1 Antibody (NBP1-81254)

Discover more about diseases related to MCCC1 Antibody (NBP1-81254).
 

Pathways for MCCC1 Antibody (NBP1-81254)

View related products by pathway.

Blogs on MCCC1

There are no specific blogs for MCCC1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCCC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MCCC1